SitesBLAST
Comparing Pf6N2E2_2116 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2116 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
76% identity, 98% coverage: 10:447/447 of query aligns to 8:446/446 of P0AES2
- Y150 (= Y152) mutation to F: Reduces activity 100-fold.
- K207 (= K209) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D237) binding
- E266 (= E268) binding
- N289 (= N291) binding
- H339 (= H341) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N343) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D368) mutation D->A,N: Reduces activity over 100-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
76% identity, 98% coverage: 10:447/447 of query aligns to 6:444/444 of 1ecqA
- active site: K203 (= K207), K205 (= K209), D233 (= D237), N235 (= N239), E258 (= E262), N287 (= N291), M288 (= M292), D311 (= D315), H337 (= H341), N339 (= N343), I363 (= I367)
- binding 4-deoxyglucarate: N25 (= N29), H30 (= H34), T101 (= T105), Y148 (= Y152), F150 (= F154), K205 (= K209), D233 (= D237), N235 (= N239), N287 (= N291), H337 (= H341), S338 (= S342), N339 (= N343), H366 (= H370), R420 (= R423)
- binding magnesium ion: D233 (= D237), E258 (= E262), N287 (= N291)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
76% identity, 98% coverage: 10:447/447 of query aligns to 6:444/444 of 1ec9D
- active site: K203 (= K207), K205 (= K209), D233 (= D237), N235 (= N239), E258 (= E262), N287 (= N291), M288 (= M292), D311 (= D315), H337 (= H341), N339 (= N343), I363 (= I367)
- binding magnesium ion: D233 (= D237), E258 (= E262), N287 (= N291)
- binding xylarohydroxamate: H30 (= H34), T101 (= T105), Y148 (= Y152), F150 (= F154), K205 (= K209), D233 (= D237), N235 (= N239), N287 (= N291), H337 (= H341), S338 (= S342), N339 (= N343), H366 (= H370), R420 (= R423)
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
76% identity, 98% coverage: 10:447/447 of query aligns to 4:442/442 of 1ec8A
- active site: K201 (= K207), K203 (= K209), D231 (= D237), N233 (= N239), E256 (= E262), N285 (= N291), M286 (= M292), D309 (= D315), H335 (= H341), N337 (= N343), I361 (= I367)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N29), H28 (= H34), T99 (= T105), Y146 (= Y152), K203 (= K209), D231 (= D237), N233 (= N239), N285 (= N291), H335 (= H341), S336 (= S342), N337 (= N343), H364 (= H370), R418 (= R423)
- binding magnesium ion: D231 (= D237), E256 (= E262), N285 (= N291)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
76% identity, 98% coverage: 10:447/447 of query aligns to 5:443/443 of 1jctA
- active site: K202 (= K207), K204 (= K209), D232 (= D237), N234 (= N239), E257 (= E262), N286 (= N291), M287 (= M292), D310 (= D315), H336 (= H341), L338 (≠ N343), I362 (= I367)
- binding d-glucarate: N24 (= N29), H29 (= H34), T100 (= T105), Y147 (= Y152), F149 (= F154), K204 (= K209), D232 (= D237), N286 (= N291), S337 (= S342), R419 (= R423)
- binding magnesium ion: D232 (= D237), E257 (= E262), N286 (= N291)
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
68% identity, 98% coverage: 10:445/447 of query aligns to 3:428/428 of 3p0wB
- active site: K189 (= K207), K191 (= K209), D219 (= D237), N221 (= N239), E244 (= E262), N273 (= N291), D297 (= D315), H323 (= H341), N325 (= N343)
- binding d-glucarate: H27 (= H34), Y134 (= Y152), K191 (= K209), D219 (= D237), N221 (= N239), N273 (= N291), H323 (= H341), N325 (= N343), H352 (= H370), R406 (= R423)
- binding magnesium ion: D219 (= D237), E244 (= E262), N273 (= N291)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
68% identity, 98% coverage: 10:445/447 of query aligns to 3:424/425 of 3nxlC
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
63% identity, 98% coverage: 9:447/447 of query aligns to 3:430/432 of 3n6hB
- active site: K189 (= K207), K191 (= K209), D219 (= D237), N221 (= N239), E244 (= E262), N273 (= N291), D297 (= D315), H323 (= H341), N325 (= N343)
- binding magnesium ion: D219 (= D237), E244 (= E262), N273 (= N291)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
63% identity, 98% coverage: 9:447/447 of query aligns to 2:426/426 of 3pfrA
- active site: K185 (= K207), K187 (= K209), D215 (= D237), N217 (= N239), E240 (= E262), N269 (= N291), D293 (= D315), H319 (= H341), N321 (= N343)
- binding d-glucarate: N22 (= N29), H27 (= H34), Y130 (= Y152), F132 (= F154), K187 (= K209), D215 (= D237), N217 (= N239), N269 (= N291), H319 (= H341), S320 (= S342), N321 (= N343), H348 (= H370)
- binding magnesium ion: D215 (= D237), E240 (= E262), N269 (= N291)
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
60% identity, 98% coverage: 10:446/447 of query aligns to 3:440/441 of 3nfuA
- active site: K201 (= K207), K203 (= K209), D231 (= D237), N233 (= N239), E256 (= E262), N285 (= N291), D309 (= D315), H335 (= H341), N337 (= N343)
- binding magnesium ion: D231 (= D237), N233 (= N239), E256 (= E262), D257 (= D263), N285 (= N291)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
38% identity, 95% coverage: 12:436/447 of query aligns to 6:420/427 of 4it1D
- active site: S51 (≠ V57), D54 (≠ G60), A98 (≠ R101), Y150 (= Y152), K194 (= K207), K196 (= K209), D224 (= D237), N226 (= N239), Y247 (= Y260), E249 (= E262), T271 (= T290), N272 (= N291), M273 (= M292), D296 (= D315), H323 (= H341), S324 (= S342), N325 (= N343), C349 (≠ I367), D350 (= D368)
- binding magnesium ion: D224 (= D237), E249 (= E262), N272 (= N291)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
34% identity, 98% coverage: 7:443/447 of query aligns to 8:425/427 of 3va8A
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
35% identity, 97% coverage: 11:442/447 of query aligns to 3:417/420 of 3vc6A
- active site: D52 (≠ G60), H55 (vs. gap), Y146 (= Y152), K188 (= K207), K190 (= K209), D218 (= D237), N220 (= N239), E243 (= E262), N266 (= N291), M267 (= M292), D290 (= D315), H317 (= H341), S318 (= S342), N319 (= N343), H321 (= H345), C343 (≠ I367), D344 (= D368)
- binding magnesium ion: D218 (= D237), E243 (= E262), N266 (= N291)
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
28% identity, 66% coverage: 114:409/447 of query aligns to 98:361/366 of 3dg6A
- active site: M134 (≠ E182), K160 (= K207), K162 (= K209), D191 (= D237), N193 (= N239), E217 (= E262), D242 (≠ K287), E243 (≠ T288), S244 (≠ A289), K266 (≠ P312), G292 (≠ N343), N293 (= N344), Q294 (≠ H345), G319 (≠ I367), E320 (≠ D368), L321 (≠ T369)
- binding magnesium ion: D191 (= D237), E217 (= E262), D242 (≠ K287)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: M134 (≠ E182), K160 (= K207), K162 (= K209), D191 (= D237), N193 (= N239), D242 (≠ K287), K266 (≠ P312), N293 (= N344), Q294 (≠ H345), I295 (≠ F346)
Sites not aligning to the query:
3rcyF Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from roseovarius sp. Tm1035
25% identity, 85% coverage: 42:420/447 of query aligns to 25:384/397 of 3rcyF
- active site: K165 (≠ G202), D167 (≠ Q204), R175 (≠ K209), G208 (≠ D237), H210 (≠ N239), E234 (= E262), G259 (≠ N291), E260 (≠ M292), Q281 (≠ D315), A283 (≠ H317), H310 (= H341), A313 (≠ N344), L332 (≠ I364), E335 (≠ I367)
- binding magnesium ion: E234 (= E262), E260 (≠ M292)
- binding alpha-D-ribofuranose: R85 (= R96), P86 (≠ D97), P239 (≠ A267), A266 (≠ R298), E267 (= E299)
2ps2A Crystal structure of putative mandelate racemase/muconate lactonizing enzyme from aspergillus oryzae
25% identity, 68% coverage: 114:415/447 of query aligns to 95:361/361 of 2ps2A
- active site: S132 (≠ Y152), Q156 (= Q204), S157 (≠ D205), V158 (≠ F206), K159 (= K207), D187 (= D237), E213 (= E262), D236 (≠ N291), E237 (≠ M292), K260 (≠ P312), Q287 (≠ H341), E288 (≠ S342), T289 (≠ N343), C313 (≠ I367), I314 (≠ D368), L315 (≠ T369)
- binding magnesium ion: D187 (= D237), E213 (= E262), D236 (≠ N291)
Sites not aligning to the query:
3u4fA Crystal structure of a mandelate racemase (muconate lactonizing enzyme family protein) from roseovarius nubinhibens
25% identity, 67% coverage: 114:411/447 of query aligns to 86:364/371 of 3u4fA
- active site: S122 (≠ D158), K150 (= K207), R152 (≠ K209), D162 (≠ I219), D188 (= D237), N190 (= N239), F213 (≠ A261), E214 (= E262), D235 (≠ R282), G239 (≠ L286), E240 (≠ K287), Q261 (≠ D315), D263 (≠ H317), H290 (= H341), A292 (≠ N343), N293 (= N344), K313 (≠ T365), E316 (vs. gap), I319 (vs. gap), G321 (vs. gap)
- binding magnesium ion: D188 (= D237), E214 (= E262), S229 (≠ M277), L232 (≠ F280), E240 (≠ K287)
Sites not aligning to the query:
3i6tB Crystal structure of muconate cycloisomerase from jannaschia sp.
26% identity, 76% coverage: 71:410/447 of query aligns to 71:361/364 of 3i6tB
- active site: S136 (≠ Y152), K161 (= K207), K163 (= K209), D191 (= D237), N193 (= N239), E217 (= E262), D242 (≠ N291), E243 (≠ M292), S262 (≠ D310), K264 (≠ P312), G291 (≠ N343), D292 (≠ N344), M293 (≠ H345), C317 (vs. gap), E318 (vs. gap), F319 (vs. gap)
- binding magnesium ion: D191 (= D237), E217 (= E262), D242 (≠ N291)
Sites not aligning to the query:
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
26% identity, 45% coverage: 202:404/447 of query aligns to 166:357/373 of 3cb3A
- active site: K171 (= K207), K173 (= K209), D202 (= D237), N204 (= N239), E228 (= E262), G253 (≠ N291), E254 (≠ M292), M275 (≠ L313), D277 (= D315), H304 (= H341), F305 (≠ I348), A306 (≠ S349), E324 (≠ I367)
- binding l-glucaric acid: K171 (= K207), K173 (= K209), D202 (= D237), E254 (≠ M292), H304 (= H341)
- binding magnesium ion: D202 (= D237), E228 (= E262), A243 (≠ M277), F246 (= F280), E254 (≠ M292)
Sites not aligning to the query:
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
26% identity, 45% coverage: 202:404/447 of query aligns to 155:346/363 of 2og9A
- active site: K160 (= K207), K162 (= K209), D191 (= D237), N193 (= N239), E217 (= E262), G242 (≠ N291), E243 (≠ M292), M264 (≠ L313), D266 (= D315), H293 (= H341), F294 (≠ I348), A295 (≠ S349), E313 (≠ I367)
- binding calcium ion: A232 (≠ M277), F235 (= F280)
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_2116 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2116
MTTPEASKAPIITSMQIVPVAGHDGMLLNLSGAHGPFFTRNIVILKDNAGHTGVGEVPGG
ERIRQTLEDARSLVVGSPIGTYQKILNTVRQAFADRDAGGRGLQTFDLRITIHAVTGLEA
ALLDLLGQHLDVPVAALLGEGQQRDEVKMLGYLFYVGDRQQTDLPYRSEPDADNDWFRVR
HEKALDADAVVRLAEAAHSRYGFQDFKLKGGVLQGDAEIEAVTALAERFPQARITLDPNG
AWSLKEAIRLCRDQHKVLAYAEDPCGAENGYSGREVMAEFRRATGLKTATNMIATDWREM
GHAITLQSVDIPLADPHFWTMQGSVRVAQMCNEWGLTWGSHSNNHFDISLAMFTHVAAAA
PGEITAIDTHWIWQDGQRLTKAPLQIQGGCVQVPKKPGLGIELDTDQLAKAHELYKGMGL
GARDDAVAMQFLIPGWTFNNKRPCLVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory