SitesBLAST
Comparing Pf6N2E2_2127 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2127 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
29% identity, 84% coverage: 74:465/469 of query aligns to 10:394/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: R23 (≠ T87), G40 (≠ A113), L41 (≠ F114)
- binding 2-oxoglutaric acid: D213 (= D282), P214 (≠ V283), Y215 (= Y284), G216 (≠ A285), E217 (= E286), G241 (= G310), T242 (≠ S311), I246 (≠ S315)
- binding (2E)-pent-2-enedioic acid: G40 (≠ A113), Y130 (≠ F203), N184 (= N253), R376 (= R444)
- binding glutamic acid: S20 (≠ H84), V22 (≠ S86), L131 (≠ Y204), V360 (≠ A428), A364 (≠ I432), R369 (= R437)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G177), S105 (≠ A178), Q106 (≠ L179), Y130 (≠ F203), N184 (= N253), D212 (= D281), P214 (≠ V283), Y215 (= Y284), T242 (≠ S311), S244 (≠ A313), K245 (= K314), R252 (= R321)
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
29% identity, 84% coverage: 74:465/469 of query aligns to 10:394/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: S20 (≠ H84), V22 (≠ S86), R23 (≠ T87), L131 (≠ Y204), Q135 (= Q208), A364 (≠ I432), R369 (= R437)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: R23 (≠ T87), G40 (≠ A113), Y130 (≠ F203), L131 (≠ Y204), A132 (= A205), N184 (= N253), R376 (= R444)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G177), S105 (≠ A178), Q106 (≠ L179), Y130 (≠ F203), V179 (≠ M248), N184 (= N253), D212 (= D281), P214 (≠ V283), Y215 (= Y284), T242 (≠ S311), S244 (≠ A313), K245 (= K314), R252 (= R321)
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
29% identity, 84% coverage: 74:465/469 of query aligns to 10:394/404 of 3aowC
- binding 2-oxoglutaric acid: R23 (≠ T87), Y70 (≠ T143), Y130 (≠ F203), L275 (= L343)
- binding pyridoxal-5'-phosphate: G104 (= G177), S105 (≠ A178), Q106 (≠ L179), Y130 (≠ F203), V179 (≠ M248), N184 (= N253), D212 (= D281), P214 (≠ V283), Y215 (= Y284), T242 (≠ S311), S244 (≠ A313), K245 (= K314), R252 (= R321)
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
29% identity, 84% coverage: 74:465/469 of query aligns to 10:394/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G177), S105 (≠ A178), Q106 (≠ L179), Y130 (≠ F203), V179 (≠ M248), N184 (= N253), D212 (= D281), P214 (≠ V283), Y215 (= Y284), T242 (≠ S311), S244 (≠ A313), K245 (= K314), R252 (= R321)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
29% identity, 85% coverage: 72:468/469 of query aligns to 5:398/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G177), S103 (≠ A178), Q104 (≠ L179), Y128 (≠ F203), V177 (≠ M248), N182 (= N253), D210 (= D281), P212 (≠ V283), Y213 (= Y284), T240 (≠ S311), S242 (≠ A313), K243 (= K314), R250 (= R321)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
29% identity, 77% coverage: 108:468/469 of query aligns to 37:403/405 of 2zc0A
- active site: Y132 (≠ F203), D214 (= D281), A216 (≠ V283), S246 (≠ A313)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G177), G107 (≠ A178), T108 (≠ L179), Y132 (≠ F203), N186 (= N253), D214 (= D281), A216 (≠ V283), Y217 (= Y284), T244 (≠ S311), S246 (≠ A313), K247 (= K314), R254 (= R321)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
28% identity, 80% coverage: 97:469/469 of query aligns to 24:393/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G39 (≠ S112), G40 (≠ A113), G99 (= G177), S100 (≠ A178), Q101 (≠ L179), Y125 (≠ F203), N174 (= N253), D202 (= D281), Y205 (= Y284), S235 (= S311), S237 (≠ A313), K238 (= K314), R245 (= R321), R368 (= R444)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
28% identity, 80% coverage: 97:469/469 of query aligns to 24:393/397 of Q72LL6
- G40 (≠ A113) binding
- Y70 (≠ T143) binding
- N174 (= N253) binding ; binding
- R245 (= R321) binding
- R368 (= R444) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
28% identity, 80% coverage: 97:469/469 of query aligns to 20:389/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G35 (≠ S112), G36 (≠ A113), G95 (= G177), S96 (≠ A178), Q97 (≠ L179), Y121 (≠ F203), N170 (= N253), D198 (= D281), Y201 (= Y284), S231 (= S311), S233 (≠ A313), K234 (= K314), R241 (= R321), R364 (= R444)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
28% identity, 80% coverage: 97:469/469 of query aligns to 20:389/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G177), S96 (≠ A178), Q97 (≠ L179), Y121 (≠ F203), N170 (= N253), D198 (= D281), A200 (≠ V283), Y201 (= Y284), S231 (= S311), S233 (≠ A313), K234 (= K314), R241 (= R321)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
28% identity, 78% coverage: 106:469/469 of query aligns to 25:385/389 of 2z1yA
- binding leucine: G32 (≠ A113), Y117 (≠ F203), R360 (= R444)
- binding pyridoxal-5'-phosphate: G91 (= G177), S92 (≠ A178), Q93 (≠ L179), Y117 (≠ F203), N166 (= N253), D194 (= D281), Y197 (= Y284), S227 (= S311), S229 (≠ A313), K230 (= K314), R237 (= R321)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
28% identity, 75% coverage: 92:443/469 of query aligns to 25:393/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G177), S113 (≠ A178), Q114 (≠ L179), Y138 (≠ F203), N194 (= N253), D222 (= D281), P224 (≠ V283), Y225 (= Y284), T252 (≠ S311), S254 (≠ A313), K255 (= K314), R262 (= R321)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
26% identity, 73% coverage: 97:437/469 of query aligns to 11:360/388 of 8tn3A
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
29% identity, 82% coverage: 82:466/469 of query aligns to 2:368/368 of 1v2fA
- active site: F112 (= F203), A181 (≠ L271), A183 (≠ R273), K222 (= K314)
- binding hydrocinnamic acid: F15 (= F96), Q32 (≠ S112), G33 (≠ A113), Y57 (≠ D135), F112 (= F203), F253 (≠ L343), R347 (= R444)
- binding pyridoxal-5'-phosphate: G86 (= G177), A87 (= A178), T88 (≠ L179), F112 (= F203), N163 (= N253), D191 (= D281), V193 (= V283), Y194 (= Y284), S219 (= S311), K222 (= K314), R230 (= R321)
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
29% identity, 82% coverage: 82:466/469 of query aligns to 2:368/368 of 1v2eA
- active site: F112 (= F203), A181 (≠ L271), A183 (≠ R273), K222 (= K314)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: F15 (= F96), Q32 (≠ S112), G33 (≠ A113), F112 (= F203), K222 (= K314), F309 (= F402), R347 (= R444)
- binding pyridoxal-5'-phosphate: G86 (= G177), A87 (= A178), T88 (≠ L179), F112 (= F203), D191 (= D281), V193 (= V283), Y194 (= Y284), S219 (= S311), K222 (= K314), R230 (= R321)
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
25% identity, 77% coverage: 105:467/469 of query aligns to 20:411/414 of 2vgzA
2xh1A Crystal structure of human kat ii-inhibitor complex (see paper)
25% identity, 77% coverage: 105:467/469 of query aligns to 18:409/412 of 2xh1A
- binding (3s)-10-(4-aminopiperazin-1-yl)-9-fluoro-7-hydroxy-3-methyl-2,3-dihydro-8h-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylate: G26 (≠ A113), L27 (≠ F114), Y61 (≠ T143), L280 (= L343)
- binding pyridoxal-5'-phosphate: S104 (≠ A178), Q105 (≠ L179), Y129 (≠ F203), D217 (= D281), P219 (≠ V283), S247 (= S311), S249 (≠ A313), R257 (= R321)
7zlaB Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the half-closed conformation (see paper)
23% identity, 98% coverage: 4:462/469 of query aligns to 11:452/458 of 7zlaB
Sites not aligning to the query:
4ge4A Kynurenine aminotransferase ii inhibitors (see paper)
24% identity, 77% coverage: 106:467/469 of query aligns to 28:416/422 of 4ge4A
- binding (5-hydroxy-4-{[(1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G34 (≠ S112), G35 (≠ A113), L36 (≠ F114), Y68 (≠ T143), G110 (= G177), S111 (≠ A178), Q112 (≠ L179), Y136 (≠ F203), N196 (= N253), D224 (= D281), P226 (≠ V283), Y227 (= Y284), S254 (= S311), S256 (≠ A313), K257 (= K314), R264 (= R321), R393 (= R444)
Sites not aligning to the query:
5tf5A Crystal structure of human kat-2 in complex with a reversible inhibitor
24% identity, 77% coverage: 106:467/469 of query aligns to 32:422/425 of 5tf5A
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_2127 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2127
MKRYEKFADDIAELIRSGMLGPGQRVPSVRYASQTYGVSPSTVFQAYYLLERRGMIRARP
RSGYFVNTHAPSPFSEPAISSQVHESTEVDVSELVFSVLDSIKDPATIPFGSAFPSPTLF
PLQRLSRSLSSATRDMDPRMVVTDMSPGNPQLRRQIALRYMVGGLMLPMEELLVTNGALE
ALNLCLQAVTEPGDLVAIEAPAFYASLQVLERLKLKAVEIPVHPRDGIDLDVLAQTLERH
PIKACWCMTSFQNPMGATMPEERKQALVELLSRHQVPLIEDDVYAELYYGQQAPKPAKAF
DTEGLVMHCGSFAKSLAPGYRIGWVAAGRYAQKIERLKLMTSLCASMPAQAAIADYLQHG
GYDRHLRKLRYALEEQQSAMLAAIARYFPAQTRVSQPAGGYFLWLELPEQMDSLKLFQMA
LAQGISIAPGPIFSPTRRFRNCIRLNYGSPWTEASEKAMETLGRIIRSF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory