SitesBLAST
Comparing Pf6N2E2_2249 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2249 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
33% identity, 95% coverage: 1:399/420 of query aligns to 18:420/425 of O59010
- S65 (≠ T52) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A261) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 261:263) binding
- M311 (≠ L296) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ S299) binding
- V355 (= V340) binding
- D394 (= D373) binding
- M395 (= M374) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R376) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N380) binding
- D405 (≠ N384) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
33% identity, 94% coverage: 1:395/420 of query aligns to 9:407/407 of 2nwwA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
33% identity, 94% coverage: 1:395/420 of query aligns to 10:408/408 of 6bauA
- binding cysteine: S270 (= S263), M303 (≠ L296), T306 (≠ S299), A345 (= A338), G346 (= G339), V347 (= V340), G351 (≠ S344), D386 (= D373), C389 (≠ R376), T390 (= T377), N393 (= N380)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
33% identity, 94% coverage: 1:395/420 of query aligns to 10:408/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
33% identity, 94% coverage: 1:395/420 of query aligns to 15:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G56), V83 (≠ M74), I157 (≠ F152), Y164 (vs. gap), K193 (= K181), T305 (≠ S293), I306 (≠ F294), I347 (≠ K335)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: M199 (= M187), S275 (= S263), T311 (≠ S299), G356 (≠ S344), L384 (≠ I366), D391 (= D373), R394 (= R376)
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
33% identity, 94% coverage: 1:395/420 of query aligns to 18:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ V33), F46 (≠ V33), P75 (≠ N62), L91 (≠ T79), F95 (≠ V83), L130 (= L122), I133 (≠ F125), I159 (≠ L151), Y167 (vs. gap), K196 (= K181), G200 (≠ Y185), I207 (= I192), F210 (= F195), L250 (≠ G235), I262 (≠ G247), M269 (≠ I254), T334 (≠ S319), V335 (≠ F320), G336 (≠ T321), T340 (≠ L325), L343 (= L328), M399 (≠ A378)
- binding aspartic acid: S277 (= S262), S278 (= S263), T314 (≠ S299), G354 (= G339), A358 (= A343), G359 (≠ S344), D394 (= D373), R397 (= R376), T398 (= T377)
- binding sodium ion: Y89 (≠ F77), T92 (≠ A80), S93 (= S81), G306 (= G291), T308 (≠ S293), N310 (= N295), N310 (= N295), M311 (≠ L296), D312 (= D297), S349 (= S334), I350 (≠ K335), T352 (≠ M337), N401 (= N380), V402 (= V381), D405 (≠ N384)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
31% identity, 94% coverage: 1:395/420 of query aligns to 10:396/396 of 6bmiA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
32% identity, 96% coverage: 2:404/420 of query aligns to 10:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A261), S265 (= S263), M299 (≠ L296), T302 (≠ S299), T340 (≠ M337), G342 (= G339), V343 (= V340), G347 (≠ S344), D383 (= D373), R386 (= R376), T387 (= T377), N390 (= N380)
- binding decyl-beta-d-maltopyranoside: H23 (= H15), V212 (≠ L210), A216 (≠ G214)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
32% identity, 96% coverage: 2:404/420 of query aligns to 17:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
32% identity, 96% coverage: 2:404/420 of query aligns to 17:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ A261), S275 (= S262), S276 (= S263), T313 (≠ S299), G353 (= G339), V354 (= V340), A357 (= A343), G358 (≠ S344), D394 (= D373), R397 (= R376), T398 (= T377)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K181), G198 (≠ Y185), Y202 (≠ F189)
- binding sodium ion: Y87 (≠ F77), T90 (≠ A80), S91 (= S81), S276 (= S263), G305 (= G291), A306 (≠ Y292), T307 (≠ S293), N309 (= N295), N309 (= N295), M310 (≠ L296), D311 (= D297), S348 (= S334), I349 (≠ K335), G350 (= G336), T351 (≠ M337), N401 (= N380), V402 (= V381), D405 (≠ N384)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
32% identity, 96% coverage: 2:404/420 of query aligns to 14:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K181), G195 (≠ Y185), R282 (≠ E272)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A261), S272 (= S262), S273 (= S263), M307 (≠ L296), T310 (≠ S299), G353 (≠ R342), A354 (= A343), R394 (= R376), T395 (= T377)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
32% identity, 96% coverage: 2:404/420 of query aligns to 15:421/425 of 6zgbA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 95% coverage: 6:403/420 of query aligns to 33:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V66), G89 (= G67), G92 (= G70), A95 (= A73), V96 (≠ M74), Y99 (≠ F77), M163 (≠ L151), F167 (= F155), F293 (= F286), V297 (≠ L290)
- binding aspartic acid: S268 (= S262), S269 (= S263), T306 (≠ S299), G346 (= G339), I347 (≠ V340), A350 (= A343), G351 (≠ S344), D380 (= D373), R383 (= R376), T384 (= T377)
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
28% identity, 98% coverage: 3:415/420 of query aligns to 58:518/543 of P56564
- N206 (= N141) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
28% identity, 98% coverage: 3:415/420 of query aligns to 58:518/542 of P43003
- S363 (≠ A261) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ ASS 261:263) binding
- T396 (≠ S293) binding
- T402 (≠ S299) binding
- IPQAG 443:447 (≠ VARAS 340:344) binding
- D476 (= D373) binding
- R477 (≠ M374) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N380) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 95% coverage: 6:403/420 of query aligns to 25:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I57), S80 (≠ V66), G81 (= G67), G84 (= G70), Y91 (≠ F77), M156 (≠ L151), F160 (= F155), F286 (= F286), V290 (≠ L290)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V49), I148 (= I143), S262 (= S263), S263 (≠ E264), A292 (≠ Y292), T293 (≠ S293), M296 (≠ L296), T299 (≠ S299), G329 (= G336), A336 (= A343), G337 (≠ S344), D366 (= D373), R369 (= R376), N373 (= N380)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
26% identity, 97% coverage: 7:414/420 of query aligns to 29:478/503 of Q10901
- N177 (= N141) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
28% identity, 96% coverage: 1:403/420 of query aligns to 17:431/433 of 8cv2A
- binding sodium ion: Y85 (≠ F77), T88 (≠ A80), T89 (≠ S81), G319 (= G291), A320 (≠ Y292), N323 (= N295), N323 (= N295), M324 (≠ L296), D325 (= D297), N408 (= N380), D412 (≠ N384)
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
28% identity, 99% coverage: 6:420/420 of query aligns to 51:520/532 of O35874
- N201 (= N141) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
6x2zA Heaat3-ofs-asp (see paper)
27% identity, 96% coverage: 1:403/420 of query aligns to 15:418/419 of 6x2zA
- binding aspartic acid: S275 (≠ A261), S277 (= S263), T314 (≠ S299), G354 (= G339), V355 (= V340), D388 (= D373), R391 (= R376), T392 (= T377)
- binding sodium ion: Y83 (≠ F77), T86 (≠ A80), T87 (≠ S81), G306 (= G291), A307 (≠ Y292), T308 (≠ S293), I309 (≠ F294), N310 (= N295), N310 (= N295), M311 (≠ L296), M311 (≠ L296), D312 (= D297), S349 (= S334), I350 (≠ K335), G351 (= G336), A352 (≠ M337), N395 (= N380), D399 (≠ N384)
Query Sequence
>Pf6N2E2_2249 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2249
MGIALGVLVGWACHHFAGSEQSAKEIASYFSMVTDIFLRMIKMIIAPLVFATLVGGIASM
GNSRSVGRIGARAMAWFVTASVVSLLIGMGLVNLFQPGAGLNMDVAQHATAAVPVNTGDF
SLKAFIGHVFPRSIAEAMANNEILQIVVFSLFFGFALAGVKRAGYTRITDCIEELAKVMF
KITDYVMAFAPIGVFAAIASAITTQGLGLLVDYGKLIAEFYLGILILWALLFGAGYLFLG
RSVFHLGKLIREPILLAFSTASSESAYPKTIEALEKFGAPKRVSSFVLPLGYSFNLDGSM
MYQAFAILFIAQAYNIDLSFTQQLLILLTLMVTSKGMAGVARASVVVVAATLPMFNLPEA
GLLLIIGIDQFLDMARTATNVVGNSIATAVVAKSEPHEEADEDEGAGAPVRSRSEPVPVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory