Comparing Pf6N2E2_2276 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2276 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 35% coverage: 75:224/432 of query aligns to 92:226/582 of O23492
Sites not aligning to the query:
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
24% identity, 70% coverage: 65:366/432 of query aligns to 50:385/437 of 6rw3A
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
23% identity, 58% coverage: 118:366/432 of query aligns to 129:407/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
23% identity, 58% coverage: 118:366/432 of query aligns to 129:407/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
23% identity, 58% coverage: 118:366/432 of query aligns to 129:407/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
23% identity, 69% coverage: 70:366/432 of query aligns to 74:411/491 of P0AGF4
Sites not aligning to the query:
>Pf6N2E2_2276 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2276
MSSQTSNGKAIFRVVSGNFLEMFDFMVYGFYATAIAKTFFPADSAFASLMLSLATFGAGF
LMRPLGAIFLGAYIDRHGRRKGLIITLAMMAAGTVLIACVPGYATLGVAAPLLVLLGRLL
QGFSAGVELGGVSVYLAEISTPGRKGFFVSWQSASQQAAVVFAGLLGVGLNHWLSPQEMG
EWGWRVPFLVGCMIVPAIFVIRRSLEETPEFQARKHRPSLSEIVRSIGQNFGIVLAGMAL
VVMTTVSFYLITAYTPTFGKAELNLSDLDALLVTVCIGLSNFFWLPVMGALSDKVGRKPL
LLGATVLAILTAYPALSWLVANPSFSHLLIVELWLSFLYGSYNGAMVVALTEIMPVEVRT
TGFSLAYSLATATFGGFTPAACTYLIHVLDNKAAPGIWLSGAAVLGLIATLVLFKGDRHE
LRTAQASVVGGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory