Comparing Pf6N2E2_229 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_229 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
45% identity, 76% coverage: 69:282/283 of query aligns to 63:279/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
45% identity, 76% coverage: 69:282/283 of query aligns to 63:279/280 of 6j5xA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
43% identity, 77% coverage: 61:279/283 of query aligns to 79:301/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
43% identity, 77% coverage: 61:279/283 of query aligns to 78:300/303 of 8skyB
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
37% identity, 98% coverage: 2:279/283 of query aligns to 7:278/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
37% identity, 98% coverage: 2:279/283 of query aligns to 7:278/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
40% identity, 94% coverage: 16:280/283 of query aligns to 12:276/279 of 6v77B
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
39% identity, 75% coverage: 68:279/283 of query aligns to 64:274/277 of 6iymA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
41% identity, 78% coverage: 60:280/283 of query aligns to 49:248/252 of 3qdfA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
33% identity, 93% coverage: 22:283/283 of query aligns to 15:264/265 of 3r6oA
1gttA Crystal structure of hpce (see paper)
40% identity, 65% coverage: 67:250/283 of query aligns to 215:392/421 of 1gttA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
38% identity, 78% coverage: 60:281/283 of query aligns to 49:268/269 of 4dbhA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
36% identity, 69% coverage: 76:269/283 of query aligns to 15:204/218 of 6fogA
Sites not aligning to the query:
Q6P587 Oxaloacetate decarboxylase, mitochondrial; OAA decarboxylase; ODx; Acylpyruvase FAHD1; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; YisK-like protein; EC 4.1.1.112; EC 3.7.1.5 from Homo sapiens (Human) (see 4 papers)
36% identity, 69% coverage: 76:269/283 of query aligns to 17:206/221 of Q6P587
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
30% identity, 100% coverage: 1:283/283 of query aligns to 1:264/264 of 6jvwB
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
33% identity, 72% coverage: 76:279/283 of query aligns to 14:213/216 of 6sbiA
Q8R0F8 Oxaloacetate decarboxylase, mitochondrial; OAA decarboxylase; ODx; Acylpyruvase FAHD1; Acylpyruvate hydrolase; ApH; Fumarylacetoacetate hydrolase domain-containing protein 1; EC 4.1.1.112; EC 3.7.1.5 from Mus musculus (Mouse) (see paper)
33% identity, 72% coverage: 76:279/283 of query aligns to 17:216/221 of Q8R0F8
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
32% identity, 63% coverage: 75:251/283 of query aligns to 25:209/233 of 6j5yA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
31% identity, 63% coverage: 74:250/283 of query aligns to 16:197/224 of 3v77A
Q97UA0 2-dehydro-3-deoxy-D-arabinonate dehydratase; 2-keto-3-deoxy-D-arabinonate dehydratase; KdaD; EC 4.2.1.141 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 53% coverage: 127:275/283 of query aligns to 148:287/298 of Q97UA0
Sites not aligning to the query:
>Pf6N2E2_229 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_229
MKLASFIVQGRSSYGVVEGDQVIDLESLKPTLGSDLKQAIGHNRLNELSPARLARLPRIP
LADVTFLPVIPNPGKVLCIGINYATHVRETGREMPTYPMIFTRFADSQTAHLQPIVRPTA
SHKLDFEGELAVVIGKAARHVKHADALDYVAGYACYNDGSVRDWQKHTIQFVPGKNFPNT
GGFGPWLVTGDEIGDPQDLELTTRLNGEVMQHTRTSDMIFDVRQLIEYCSTFTELAPGDV
IVTGTTGGVGAFREPPVWMKPGDEVEIEIARIGTLRNSIVDEQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory