Comparing Pf6N2E2_2394 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
4gr5C Crystal structure of slgn1deltaasub in complex with ampcpp (see paper)
38% identity, 75% coverage: 5:60/75 of query aligns to 4:59/457 of 4gr5C
Sites not aligning to the query:
>Pf6N2E2_2394
MTSVFDREDIVFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGFKKECLAYIEEVWTDMRP
LSLRKKMEEQAAAAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory