SitesBLAST
Comparing Pf6N2E2_2518 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2518 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
55% identity, 59% coverage: 299:729/735 of query aligns to 1:431/440 of 3slhD
- active site: K23 (= K321), S24 (= S322), D50 (= D348), N95 (= N392), R125 (= R422), D317 (= D615), E345 (= E643), H388 (= H686), R389 (= R687), T415 (= T713)
- binding glyphosate: K23 (= K321), G97 (= G394), T98 (= T395), R125 (= R422), Q171 (= Q469), D317 (= D615), E345 (= E643), R348 (= R646), H388 (= H686), R389 (= R687)
- binding shikimate-3-phosphate: S24 (= S322), R28 (= R326), S169 (= S467), Q171 (= Q469), R196 (= R494), D317 (= D615), K344 (= K642)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S322), R28 (= R326), T98 (= T395), Q171 (= Q469), R196 (= R494), D317 (= D615), K344 (= K642)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
55% identity, 58% coverage: 307:729/735 of query aligns to 7:429/438 of Q83E11
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
55% identity, 59% coverage: 299:729/735 of query aligns to 1:427/434 of 4egrA
- active site: K23 (= K321), S24 (= S322), D50 (= D348), N95 (= N392), R125 (= R422), D313 (= D615), E341 (= E643), H384 (= H686), R385 (= R687), T411 (= T713)
- binding phosphoenolpyruvate: K23 (= K321), G97 (= G394), T98 (= T395), R125 (= R422), D313 (= D615), E341 (= E643), R344 (= R646), R385 (= R687)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
50% identity, 58% coverage: 305:729/735 of query aligns to 12:447/455 of Q9R4E4
- KS 28:29 (= KS 321:322) binding
- R33 (= R326) binding
- NAAT 98:101 (≠ NSGT 392:395) Phosphoenolpyruvate
- A100 (≠ G394) mutation to G: Confers resistance to glyphosate.
- R128 (= R422) binding
- K353 (= K642) binding
- R357 (= R646) binding
- R405 (= R687) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
50% identity, 58% coverage: 305:729/735 of query aligns to 7:442/445 of 2pqcA
- active site: K23 (= K321), S24 (= S322), D50 (= D348), N93 (= N392), R123 (= R422), D321 (= D615), E349 (= E643), H399 (= H686), R400 (= R687), T426 (= T713)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K321), S24 (= S322), R28 (= R326), T96 (= T395), R123 (= R422), S168 (= S467), Q170 (= Q469), D321 (= D615), K348 (= K642), E349 (= E643), R352 (= R646), R400 (= R687)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
50% identity, 58% coverage: 305:729/735 of query aligns to 7:442/445 of 2pqbA
- active site: K23 (= K321), S24 (= S322), D50 (= D348), N93 (= N392), R123 (= R422), D321 (= D615), E349 (= E643), H399 (= H686), R400 (= R687), T426 (= T713)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K321), S24 (= S322), R28 (= R326), A95 (≠ G394), T96 (= T395), R123 (= R422), S168 (= S467), Q170 (= Q469), D321 (= D615), K348 (= K642), E349 (= E643), R352 (= R646), R400 (= R687)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
50% identity, 58% coverage: 305:729/735 of query aligns to 7:442/445 of 2ggaA
- active site: K23 (= K321), S24 (= S322), D50 (= D348), N93 (= N392), R123 (= R422), D321 (= D615), E349 (= E643), H399 (= H686), R400 (= R687), T426 (= T713)
- binding glyphosate: K23 (= K321), A94 (≠ S393), A95 (≠ G394), T96 (= T395), R123 (= R422), D321 (= D615), E349 (= E643), R352 (= R646), R400 (= R687)
- binding shikimate-3-phosphate: S24 (= S322), R28 (= R326), S168 (= S467), A169 (= A468), Q170 (= Q469), R195 (= R494), D321 (= D615), K348 (= K642)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
50% identity, 58% coverage: 305:729/735 of query aligns to 7:442/445 of 2gg6A
- active site: K23 (= K321), S24 (= S322), D50 (= D348), N93 (= N392), R123 (= R422), D321 (= D615), E349 (= E643), H399 (= H686), R400 (= R687), T426 (= T713)
- binding shikimate-3-phosphate: S24 (= S322), R28 (= R326), T96 (= T395), S168 (= S467), Q170 (= Q469), D321 (= D615), K348 (= K642)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
49% identity, 56% coverage: 311:719/735 of query aligns to 10:418/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
49% identity, 56% coverage: 311:719/735 of query aligns to 10:418/427 of 1rf6A
- active site: K20 (= K321), S21 (= S322), D47 (= D348), N90 (= N392), D115 (≠ A417), R120 (= R422), D312 (= D615), E340 (= E643), H384 (= H686), R385 (= R687), T412 (= T713)
- binding glyphosate: K20 (= K321), G92 (= G394), T93 (= T395), R120 (= R422), Q168 (= Q469), D312 (= D615), E340 (= E643), R343 (= R646), H384 (= H686), R385 (= R687)
- binding shikimate-3-phosphate: S21 (= S322), R25 (= R326), S166 (= S467), Q168 (= Q469), R193 (= R494), I311 (= I614), D312 (= D615), K339 (= K642)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
49% identity, 56% coverage: 311:719/735 of query aligns to 10:418/427 of 1rf4A
- active site: K20 (= K321), S21 (= S322), D47 (= D348), N90 (= N392), D115 (≠ A417), R120 (= R422), D312 (= D615), E340 (= E643), H384 (= H686), R385 (= R687), T412 (= T713)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K321), S21 (= S322), R25 (= R326), G92 (= G394), T93 (= T395), R120 (= R422), S166 (= S467), A167 (= A468), Q168 (= Q469), R193 (= R494), D312 (= D615), K339 (= K642), E340 (= E643), R343 (= R646), H384 (= H686), R385 (= R687)
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
40% identity, 38% coverage: 5:280/735 of query aligns to 16:290/293 of 3gggD
- binding nicotinamide-adenine-dinucleotide: V21 (≠ L10), G22 (= G11), F23 (≠ L12), M24 (≠ I13), D45 (= D34), I46 (≠ L35), S50 (= S39), S81 (≠ A69), S82 (≠ V70), P83 (= P71), V84 (≠ I72), T86 (≠ A74), Q107 (≠ V95), S109 (= S97), G134 (= G125), T135 (≠ S126)
- binding tyrosine: G225 (≠ A215), G226 (= G216)
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
40% identity, 38% coverage: 5:280/735 of query aligns to 8:282/285 of 3ggoA
- binding 3-(4-hydroxy-phenyl)pyruvic acid: G217 (≠ A215), G218 (= G216), G219 (= G217)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V13 (≠ L10), G14 (= G11), F15 (≠ L12), M16 (≠ I13), D37 (= D34), I38 (≠ L35), S42 (= S39), S73 (≠ A69), S74 (≠ V70), P75 (= P71), T78 (≠ A74), Q99 (≠ V95), S101 (= S97), A125 (= A124), G131 (= G130), M233 (= M231)
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
40% identity, 38% coverage: 5:280/735 of query aligns to 8:282/286 of 3ggpA
- binding hydroxyphenyl propionic acid: G218 (= G216), G219 (= G217)
- binding nicotinamide-adenine-dinucleotide: V13 (≠ L10), G14 (= G11), F15 (≠ L12), M16 (≠ I13), D37 (= D34), I38 (≠ L35), S42 (= S39), S73 (≠ A69), S74 (≠ V70), P75 (= P71), T78 (≠ A74), Q99 (≠ V95), S101 (= S97), G131 (= G130), M233 (= M231)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
43% identity, 38% coverage: 5:280/735 of query aligns to 7:283/293 of 4wjiA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G9), G13 (= G11), L14 (= L12), I15 (= I13), T36 (≠ D34), R37 (≠ L35), S38 (≠ D36), T41 (≠ S39), S71 (≠ A69), V72 (= V70), P73 (= P71), A76 (= A74), V97 (= V95), S99 (= S97), A125 (= A124), S130 (= S129), M234 (= M231)
- binding tyrosine: S99 (= S97), H122 (= H121), A125 (= A124), T127 (≠ S126), R226 (= R223)
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
37% identity, 38% coverage: 1:281/735 of query aligns to 8:288/373 of 5uyyA
Sites not aligning to the query:
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
38% identity, 38% coverage: 4:281/735 of query aligns to 3:280/365 of 6u60B
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), L11 (= L12), I12 (= I13), D32 (= D34), I33 (≠ L35), A67 (= A69), P69 (= P71), E72 (≠ A74), V94 (= V95), S96 (= S97), G128 (= G130)
- binding tyrosine: K126 (≠ Q128)
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
36% identity, 38% coverage: 5:282/735 of query aligns to 9:284/286 of 3b1fA
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
29% identity, 57% coverage: 306:725/735 of query aligns to 7:424/426 of 3nvsA
- active site: K22 (= K321), S23 (= S322), D49 (= D348), N94 (= N392), P119 (≠ A417), R124 (= R422), H128 (≠ R426), Q135 (≠ E433), Y142 (≠ T440), E144 (≠ A441), A247 (≠ S537), A255 (≠ S545), D314 (≠ E607), E342 (= E643), H386 (= H686), R387 (= R687), K412 (≠ T713)
- binding glyphosate: K22 (= K321), G96 (= G394), R124 (= R422), Q172 (= Q469), D314 (≠ E607), E342 (= E643), R345 (= R646), H386 (= H686), R387 (= R687)
- binding magnesium ion: E123 (≠ K421), Q145 (≠ A442)
- binding shikimate-3-phosphate: K22 (= K321), S23 (= S322), R27 (= R326), T97 (= T395), S170 (= S467), S171 (≠ A468), Q172 (= Q469), S198 (≠ P490), Y201 (≠ T493), D314 (≠ E607), N337 (≠ E638), K341 (= K642)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S322), R27 (= R326), Q172 (= Q469), Y201 (≠ T493), D314 (≠ E607), K341 (= K642)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
29% identity, 57% coverage: 306:725/735 of query aligns to 7:424/426 of Q9KRB0
Query Sequence
>Pf6N2E2_2518 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2518
MIGRLVVVGLGLIGGSFAKGLRESGLCREVVGVDLDPQSRKLAVELGVVDRCEDDLAIAC
QGADVIQLAVPILAMEKLLARLATMNLGQAILTDVGSAKGNVVRAATEAFGGMPARFVPG
HPIAGSEQSGVEASNAELFRRHKVILTPLDQTDPAALAVVDRLWRELGADVEHMQVERHD
EVLAATSHLPHLLAFGLVDSLAKRNENLEIFRYAAGGFRDFTRIAGSDPVMWHDIFLANR
EAVLRTLDTFRSDLDALRDAVDAGDGHQLLGVFTRARVAREHFSKILARRAYVDAMNSND
LIFLAQPGGSLSGRIRVPGDKSISHRSIMLGSLAEGVTEVEGFLEGEDALATLQAFRDMG
VVIEGPHHGRVTIHGVGLHGLKPAPGPIYLGNSGTSMRLLSGLLAAQDFDSTLTGDASLS
KRPMNRVANPLREMGAVIETAADGRPPMIIRGGNKLKGLTYTMPMASAQVKSCLLLAGLY
AEGKTTVTEPAPTRDHTERMLRGFGYPVTVDGATASVESGNKLTATHIEVPGDISSSAFF
LVAASIAEGSDLVLEHVGINPTRTGVIDILRLMGADITLENQREVGGEPVADLRVRAAKL
KGIEIPEALVPLAIDEFPVLFVAAACAEGRTVLTGAEELRVKESDRIQVMADGLLALGVK
CQPTPDGIIIDGGQIGGGEVHGHGDHRIAMAFSVASLRASAPIRIHDCANVATSFPNFLA
LCAQVGIRVAQEAQS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory