Comparing Pf6N2E2_2539 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2539 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09110 3-ketoacyl-CoA thiolase, peroxisomal; Acetyl-CoA C-myristoyltransferase; Acetyl-CoA acyltransferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase; EC 2.3.1.16; EC 2.3.1.155; EC 2.3.1.9 from Homo sapiens (Human) (see 3 papers)
44% identity, 99% coverage: 3:391/394 of query aligns to 37:420/424 of P09110
Sites not aligning to the query:
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
42% identity, 99% coverage: 2:393/394 of query aligns to 5:390/390 of 2d3tC
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
36% identity, 99% coverage: 1:391/394 of query aligns to 1:390/392 of P45359
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
37% identity, 97% coverage: 4:385/394 of query aligns to 2:381/389 of 2vu2A
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
37% identity, 97% coverage: 4:385/394 of query aligns to 4:383/391 of 2vu1A
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
37% identity, 97% coverage: 4:385/394 of query aligns to 2:381/389 of 1dm3A
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
37% identity, 97% coverage: 4:385/394 of query aligns to 2:381/389 of 1dlvA
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
37% identity, 97% coverage: 4:385/394 of query aligns to 5:384/392 of 1ou6A
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
37% identity, 97% coverage: 5:385/394 of query aligns to 6:384/392 of P07097
5bz4K Crystal structure of a t1-like thiolase (coa-complex) from mycobacterium smegmatis (see paper)
40% identity, 100% coverage: 2:394/394 of query aligns to 1:399/400 of 5bz4K
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
37% identity, 97% coverage: 4:385/394 of query aligns to 2:381/389 of 2wkuA
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
36% identity, 99% coverage: 1:391/394 of query aligns to 1:390/392 of 4xl4A
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
37% identity, 97% coverage: 4:385/394 of query aligns to 3:382/390 of 1m1oA
P42765 3-ketoacyl-CoA thiolase, mitochondrial; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; Acyl-CoA hydrolase, mitochondrial; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1; EC 2.3.1.16; EC 2.3.1.9; EC 3.1.2.-; EC 3.1.2.1; EC 3.1.2.2 from Homo sapiens (Human) (see paper)
36% identity, 98% coverage: 1:385/394 of query aligns to 4:388/397 of P42765
4c2jD Crystal structure of human mitochondrial 3-ketoacyl-coa thiolase in complex with coa (see paper)
37% identity, 98% coverage: 1:385/394 of query aligns to 7:387/395 of 4c2jD
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
37% identity, 99% coverage: 2:393/394 of query aligns to 3:399/399 of 8oqmD
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
37% identity, 99% coverage: 2:393/394 of query aligns to 2:399/399 of 8opuC
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
37% identity, 98% coverage: 1:385/394 of query aligns to 1:385/393 of P14611
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
37% identity, 99% coverage: 2:393/394 of query aligns to 2:398/398 of 8oqoC
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
37% identity, 99% coverage: 2:393/394 of query aligns to 2:397/397 of 8oqlC
>Pf6N2E2_2539 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2539
MREVVIVDSVRTGLAKSFRGKFNMTRPDDMAAHCVDALLARNDINPASVEDCIVGAGSNE
GAQGYNIGRNVAVLSRLGTGTAGMTLNRFCSSGLQAIAIAANQIASGCSDIIVAGGVESI
SLTMKSVNTDHLINPLLKEQVPGIYFPMGQTAEIVARRYQVSREEQDRYALQSQQRTAKA
QAAGLFDDEIIPMAIKYRVEDKNTGAVQILDGVVDRDDCNRPDTTYESLAGLKPVFAEDG
SVTAGNSSQLSDGASMTLVISLEKALALGLKPKAFFRGFTVAGCEPDEMGIGPVFSVPKL
LKAKGLQIADIDLWELNEAFASQCLYSRNRLEIDPGKYNVNGGSISIGHPFGMTGSRQVG
HLVRELQRRNLRYGVVTMCVGGGMGATGLFEMVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory