Comparing Pf6N2E2_2830 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
49% identity, 95% coverage: 10:262/266 of query aligns to 10:261/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 87% coverage: 10:241/266 of query aligns to 10:243/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 87% coverage: 10:241/266 of query aligns to 10:240/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 87% coverage: 10:241/266 of query aligns to 10:237/262 of 6eb3C
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
26% identity, 80% coverage: 9:221/266 of query aligns to 13:227/278 of 4uhfA
Sites not aligning to the query:
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
26% identity, 80% coverage: 9:221/266 of query aligns to 13:227/274 of 4uhdA
Sites not aligning to the query:
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
26% identity, 80% coverage: 9:221/266 of query aligns to 13:227/272 of 4uheA
Sites not aligning to the query:
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
24% identity, 89% coverage: 3:238/266 of query aligns to 4:243/269 of 5h3hB
Sites not aligning to the query:
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
25% identity, 89% coverage: 11:248/266 of query aligns to 8:251/266 of 6ap8A
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
25% identity, 89% coverage: 11:248/266 of query aligns to 7:250/265 of 5zhtA
5zhrA Crystal structure of osd14 in complex with covalently bound kk094 (see paper)
25% identity, 89% coverage: 11:248/266 of query aligns to 7:250/265 of 5zhrA
5yz7A Crystal structure of osd14 in complex with d-ring-opened 7'-carba-4bd (see paper)
25% identity, 89% coverage: 11:248/266 of query aligns to 7:250/265 of 5yz7A
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
25% identity, 89% coverage: 11:248/266 of query aligns to 8:251/266 of 5dj5A
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
25% identity, 89% coverage: 11:248/266 of query aligns to 6:249/264 of 5zhsA
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
25% identity, 89% coverage: 11:248/266 of query aligns to 10:253/268 of 4ihaA
6brtA F-box protein cth with hydrolase (see paper)
25% identity, 89% coverage: 11:248/266 of query aligns to 27:270/285 of 6brtA
Q10QA5 Strigolactone esterase D14; Protein DWARF 14; Protein DWARF 88; Protein HIGH-TILLERING DWARF 2; EC 3.1.-.- from Oryza sativa subsp. japonica (Rice) (see 4 papers)
25% identity, 89% coverage: 11:248/266 of query aligns to 60:303/318 of Q10QA5
O07015 Sigma factor SigB regulation protein RsbQ from Bacillus subtilis (strain 168) (see paper)
24% identity, 78% coverage: 24:230/266 of query aligns to 21:234/269 of O07015
Sites not aligning to the query:
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
25% identity, 80% coverage: 22:234/266 of query aligns to 21:242/271 of 3heaA
Sites not aligning to the query:
5z7wB Crystal structure of striga hermonthica htl1 (shhtl1) (see paper)
25% identity, 93% coverage: 2:248/266 of query aligns to 1:254/271 of 5z7wB
>Pf6N2E2_2830 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2830
VGFVKLAEGDLNYRFDGPQDAPVLVLSNSLGTDLHMWDEQVAAFSEHFRVLRFDTRGHGQ
SLVTEGPYSIEQLGRDVLAMLDQLNIDKVHFCGLSMGGLIGQWLGINAGERLYKLVVCNT
AAKIGDPSVWNPRIETVLRDGKAAMVALRDASIARWFTPDFAEAQPATAKKITDMLAATS
PQGYAANCAAVRDADFREQLSSIRVPLLVIAGTEDAVTPPSGGHFIQERVRGAEYAEFYA
AHLSNVQAGAAFSARVLDFLLDSGRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory