Comparing Pf6N2E2_2832 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2832 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 42% coverage: 65:245/432 of query aligns to 88:283/583 of Q9Y7Q9
Sites not aligning to the query:
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
25% identity, 45% coverage: 48:240/432 of query aligns to 75:255/514 of Q9LT15
Sites not aligning to the query:
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
25% identity, 45% coverage: 48:240/432 of query aligns to 55:235/487 of 7aaqA
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
25% identity, 70% coverage: 81:381/432 of query aligns to 78:390/452 of Q5EXK5
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 77% coverage: 49:380/432 of query aligns to 32:381/446 of A0A0H2VG78
Sites not aligning to the query:
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
25% identity, 45% coverage: 48:240/432 of query aligns to 60:240/485 of 7aarA
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
25% identity, 36% coverage: 75:228/432 of query aligns to 66:229/475 of 4gc0A
Sites not aligning to the query:
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
25% identity, 36% coverage: 75:228/432 of query aligns to 66:229/475 of 4gbzA
Sites not aligning to the query:
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
25% identity, 36% coverage: 75:228/432 of query aligns to 66:229/475 of 4gbyA
Sites not aligning to the query:
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 37% coverage: 83:241/432 of query aligns to 90:233/582 of O23492
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
25% identity, 36% coverage: 75:228/432 of query aligns to 70:233/491 of P0AGF4
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 51% coverage: 7:228/432 of query aligns to 22:237/444 of Q8NLB7
Sites not aligning to the query:
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 37% coverage: 65:225/432 of query aligns to 93:260/559 of Q09852
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
30% identity, 41% coverage: 65:241/432 of query aligns to 55:214/403 of P77589
Sites not aligning to the query:
>Pf6N2E2_2832 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2832
MATPIISHYTGEERSKRIFAIVGASSGNLVEWFDFYVYAFCAIYFAPAFFPSDNPTVQLV
NTAGVFAAGFLMRPIGGWIFGRVADRHGRKNSMMISVLMMCFGSLLIACLPTYKDIGVWA
PLLLLFARLLQGLSVGGEYGTTATYMSEVALKGQRGFFASFQYVTLIGGQLLAVSLVVIL
QQFLNEDELRAYGWRIPFVVGAVAALISLFLRRSLKETSSKEMRENKDAGSIMALFRDHK
AAFITVLGYTAGGSLIFYTFTTYMQKYLVNTAGLHAKTASYIMTGALFLYMCMQPLFGML
ADKIGRRNSMLWFGGLGALCTVPILLTLKSISSPFLAFVLITLALAIVSFYTSISGLVKA
EMFPPEVRALGVGLAYAVANAIFGGSAEYVALSLKAQGMENAFYWYVTVMMVVAFLFSLR
LPKQPAYLHHDL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory