Comparing Pf6N2E2_2991 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2991 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7w2iA Crystal structure of log (rv1205) from mycobacterium tuberculosis (see paper)
28% identity, 48% coverage: 80:259/372 of query aligns to 2:177/183 of 7w2iA
O05306 Cytokinin riboside 5'-monophosphate phosphoribohydrolase; Protein LONELY GUY homolog; LOG homolog; EC 3.2.2.n1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 48% coverage: 80:259/372 of query aligns to 6:181/187 of O05306
Q5ZC82 Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG; Protein LONELY GUY; EC 3.2.2.n1 from Oryza sativa subsp. japonica (Rice) (see paper)
31% identity, 48% coverage: 85:261/372 of query aligns to 36:216/242 of Q5ZC82
P48636 Cytokinin riboside 5'-monophosphate phosphoribohydrolase; AMP nucleosidase; PaLOG; EC 3.2.2.n1; EC 3.2.2.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 42% coverage: 85:241/372 of query aligns to 4:157/195 of P48636
>Pf6N2E2_2991 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2991
MPYKPNDLLSRHFENHGHDLTRKVEEQLNLVSPNSPNLPIYRDMILTVLRMAQEDHNRWN
AKITLQALRELEHAFRTLEQFKGRRKVTVFGSARTPIEHPLYGLARELGAALARSDMMVI
TGAGGGIMAAAHEGAGRDHSLGFNITLPFEQHANPTVEGTPNLLPFHFFFTRKLFFVKEA
DALVLCPGGFGTLDEALEVLTLVQTGKSPLVPVVLLDVPGGKFWQGALNFIREQLEENRY
ILPTDMKLMRLVYNAEEAVEEINQFYRNFHSSRWLKHQFVIRMNHKLNEQALQQMQGEFA
DLCLNDCFHQHDYSGEEHDEAQFSHLTRLAFAFNARDHGRLRELVDYINLPQNWAQPASK
PHPLTWEPIKVT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory