SitesBLAST
Comparing Pf6N2E2_3126 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3126 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4f3xA Crystal structure of putative aldehyde dehydrogenase from sinorhizobium meliloti 1021 complexed with NAD
64% identity, 98% coverage: 8:482/485 of query aligns to 2:476/476 of 4f3xA
- active site: N150 (= N156), K173 (= K179), E247 (= E253), C281 (= C287), E379 (= E385), D456 (= D462)
- binding nicotinamide-adenine-dinucleotide: I146 (= I152), A147 (= A153), P148 (= P154), W149 (= W155), K173 (= K179), E176 (= E182), G205 (= G211), G209 (= G215), I213 (≠ V219), I223 (≠ L229), G225 (= G231), D226 (= D232), T229 (= T235), G249 (= G255), C281 (= C287), Q328 (= Q334), R331 (= R337), E379 (= E385), F381 (= F387)
P77674 Gamma-aminobutyraldehyde dehydrogenase; ABALDH; 1-pyrroline dehydrogenase; 4-aminobutanal dehydrogenase; 5-aminopentanal dehydrogenase; EC 1.2.1.19; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
63% identity, 97% coverage: 12:481/485 of query aligns to 5:474/474 of P77674
1wndA Escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase as determined by kinetics and crystal structure (see paper)
63% identity, 97% coverage: 12:481/485 of query aligns to 5:474/474 of 1wndA
- active site: N149 (= N156), K172 (= K179), E246 (= E253), C280 (= C287), E378 (= E385), D455 (= D462)
- binding calcium ion: G249 (= G256), K250 (= K257), A251 (= A258), G405 (= G412), L406 (= L413), A407 (= A414), Y427 (= Y434)
1wnbB Escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase (complexed with nadh and betaine aldehyde) (see paper)
63% identity, 97% coverage: 12:481/485 of query aligns to 5:474/474 of 1wnbB
- active site: N149 (= N156), K172 (= K179), E246 (= E253), C280 (= C287), E378 (= E385), D455 (= D462)
- binding betaine aldehyde: D279 (= D286), F436 (= F443), L438 (= L445)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I145 (= I152), A146 (= A153), W148 (= W155), K172 (= K179), G204 (= G211), G208 (= G215), D209 (≠ S216), T223 (= T230), G224 (= G231), S225 (≠ D232), T228 (= T235), H231 (≠ K238), G248 (= G255), E378 (= E385)
1wnbA Escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase (complexed with nadh and betaine aldehyde) (see paper)
63% identity, 97% coverage: 12:481/485 of query aligns to 5:474/474 of 1wnbA
- active site: N149 (= N156), K172 (= K179), E246 (= E253), C280 (= C287), E378 (= E385), D455 (= D462)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I145 (= I152), A146 (= A153), W148 (= W155), K172 (= K179), G204 (= G211), G208 (= G215), D209 (≠ S216), G224 (= G231), S225 (≠ D232), T228 (= T235), H231 (≠ K238), G248 (= G255), F380 (= F387)
4neaA 1.90 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) from staphylococcus aureus in complex with NAD+ and bme-free cys289 (see paper)
39% identity, 97% coverage: 14:485/485 of query aligns to 22:499/505 of 4neaA
- active site: N166 (= N156), K189 (= K179), E264 (= E253), C298 (= C287), E399 (= E385), E476 (≠ D462)
- binding nicotinamide-adenine-dinucleotide: P164 (= P154), K189 (= K179), E192 (= E182), G222 (= G211), G226 (= G215), G242 (= G231), G243 (≠ D232), T246 (= T235), H249 (≠ K238), I250 (= I239), C298 (= C287), E399 (= E385), F401 (= F387)
4o6rA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
40% identity, 97% coverage: 8:477/485 of query aligns to 2:475/489 of 4o6rA
- active site: N150 (= N156), K173 (= K179), E248 (= E253), C282 (= C287), E383 (= E385), E460 (≠ D462)
- binding adenosine monophosphate: I146 (= I152), V147 (≠ A153), K173 (= K179), G206 (= G211), G210 (= G215), Q211 (≠ S216), F224 (≠ L229), G226 (= G231), S227 (≠ D232), T230 (= T235), R233 (≠ K238)
5gtlA NADPH complex structure of aldehyde dehydrogenase from bacillus cereus
37% identity, 96% coverage: 12:477/485 of query aligns to 19:486/491 of 5gtlA
- active site: N165 (= N156), K188 (= K179), E263 (= E253), C297 (= C287), E394 (= E385), E471 (≠ D462)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I161 (= I152), P163 (= P154), K188 (= K179), A190 (≠ S181), E191 (= E182), Q192 (≠ H183), G221 (= G211), G225 (= G215), G241 (= G231), S242 (≠ D232), T245 (= T235), L264 (= L254), C297 (= C287), E394 (= E385), F396 (= F387)
5gtkA NAD+ complex structure of aldehyde dehydrogenase from bacillus cereus
37% identity, 96% coverage: 12:477/485 of query aligns to 19:486/491 of 5gtkA
- active site: N165 (= N156), K188 (= K179), E263 (= E253), C297 (= C287), E394 (= E385), E471 (≠ D462)
- binding nicotinamide-adenine-dinucleotide: I161 (= I152), I162 (≠ A153), P163 (= P154), W164 (= W155), K188 (= K179), E191 (= E182), G221 (= G211), G225 (= G215), A226 (≠ S216), F239 (≠ L229), G241 (= G231), S242 (≠ D232), T245 (= T235), Y248 (≠ K238), L264 (= L254), C297 (= C287), Q344 (= Q334), R347 (= R337), E394 (= E385), F396 (= F387)
4go4A Crystal structure of pnpe in complex with nicotinamide adenine dinucleotide
40% identity, 96% coverage: 12:477/485 of query aligns to 5:473/487 of 4go4A
- active site: N149 (= N156), K172 (= K179), E247 (= E253), C281 (= C287), E381 (= E385), E458 (≠ D462)
- binding nicotinamide-adenine-dinucleotide: I145 (= I152), V146 (≠ A153), W148 (= W155), N149 (= N156), F154 (≠ M161), K172 (= K179), G205 (= G211), G209 (= G215), Q210 (≠ S216), F223 (≠ L229), T224 (= T230), G225 (= G231), S226 (≠ D232), T229 (= T235), E247 (= E253), G249 (= G255), C281 (= C287), E381 (= E385), F383 (= F387)
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
37% identity, 98% coverage: 12:484/485 of query aligns to 8:485/489 of 4cazA
- active site: N152 (= N156), K175 (= K179), E251 (= E253), C285 (= C287), E386 (= E385), E463 (≠ D462)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (= I152), G149 (≠ A153), W151 (= W155), N152 (= N156), K175 (= K179), E178 (= E182), G208 (= G211), G212 (= G215), F226 (≠ L229), T227 (= T230), G228 (= G231), G229 (≠ D232), T232 (= T235), V236 (≠ I239), E251 (= E253), L252 (= L254), C285 (= C287), E386 (= E385), F388 (= F387)
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
37% identity, 98% coverage: 12:484/485 of query aligns to 8:485/489 of 2woxA
- active site: N152 (= N156), K175 (= K179), E251 (= E253), C285 (= C287), E386 (= E385), E463 (≠ D462)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (= I152), G149 (≠ A153), W151 (= W155), N152 (= N156), K175 (= K179), S177 (= S181), E178 (= E182), G208 (= G211), G212 (= G215), F226 (≠ L229), T227 (= T230), G228 (= G231), G229 (≠ D232), T232 (= T235), V236 (≠ I239), E251 (= E253), L252 (= L254), C285 (= C287), E386 (= E385), F388 (= F387)
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
37% identity, 98% coverage: 12:484/485 of query aligns to 8:485/489 of 2wmeA
- active site: N152 (= N156), K175 (= K179), E251 (= E253), C285 (= C287), E386 (= E385), E463 (≠ D462)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (≠ A153), W151 (= W155), K175 (= K179), S177 (= S181), E178 (= E182), G208 (= G211), G212 (= G215), F226 (≠ L229), G228 (= G231), G229 (≠ D232), T232 (= T235), V236 (≠ I239)
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
37% identity, 98% coverage: 12:484/485 of query aligns to 9:486/490 of Q9HTJ1
- GAWN 150:153 (≠ APWN 153:156) binding
- K162 (= K165) active site, Charge relay system
- KPSE 176:179 (= KPSE 179:182) binding
- G209 (= G211) binding
- GTST 230:233 (≠ DIVT 232:235) binding
- E252 (= E253) active site, Proton acceptor
- C286 (= C287) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E385) binding
- E464 (≠ D462) active site, Charge relay system
Q9H2A2 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 from Homo sapiens (Human) (see paper)
35% identity, 99% coverage: 1:481/485 of query aligns to 1:487/487 of Q9H2A2
- R109 (≠ A110) mutation to A: About 65-fold loss of catalytic efficiency.
- N155 (= N156) mutation to A: Complete loss of activity.
- R451 (≠ L445) mutation to A: Complete loss of activity.
Q56YU0 Aldehyde dehydrogenase family 2 member C4; ALDH1a; Protein REDUCED EPIDERMAL FLUORESCENCE 1; EC 1.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 97% coverage: 10:478/485 of query aligns to 20:492/501 of Q56YU0
- G152 (= G136) mutation to E: In ref1-7; reduced activity on sinapaldehyde.
- G416 (≠ A402) mutation to R: In ref1-6; reduced activity on sinapaldehyde.
P17202 Aminoaldehyde dehydrogenase BADH; 4-trimethylammoniobutyraldehyde dehydrogenase BADH; Aminobutyraldehyde dehydrogenase BADH; Betaine aldehyde dehydrogenase; SoBADH; EC 1.2.1.-; EC 1.2.1.47; EC 1.2.1.19; EC 1.2.1.8 from Spinacia oleracea (Spinach) (see 3 papers)
37% identity, 96% coverage: 12:477/485 of query aligns to 10:482/497 of P17202
- I28 (≠ L29) binding
- D96 (≠ N95) binding
- SPW 156:158 (≠ APW 153:155) binding
- Y160 (= Y157) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-(trimethylamino)butanal.
- W167 (= W164) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- KPSE 182:185 (= KPSE 179:182) binding
- L186 (≠ H183) binding
- SSAT 236:239 (≠ DIVT 232:235) binding
- V251 (≠ L247) binding in other chain
- L258 (= L254) binding
- W285 (≠ Y281) mutation to A: Decreases binding affinity for betaine aldehyde.
- E390 (= E385) binding
- A441 (≠ C436) mutation to I: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- C450 (≠ L445) mutation to S: Loss of partial inactivation by betaine aldehyde in the absence of NAD(+).
- W456 (≠ H451) binding ; mutation to A: Decreases binding affinity for betaine aldehyde.
- K460 (= K455) binding
P25553 Lactaldehyde dehydrogenase; Aldehyde dehydrogenase A; Glycolaldehyde dehydrogenase; EC 1.2.1.22; EC 1.2.1.21 from Escherichia coli (strain K12) (see 5 papers)
38% identity, 96% coverage: 4:471/485 of query aligns to 1:469/479 of P25553
- M1 (= M4) modified: Initiator methionine, Removed
- L150 (≠ A153) binding
- R161 (≠ W164) binding
- KPSE 176:179 (= KPSE 179:182) binding
- F180 (≠ H183) mutation to T: Can bind and use NADP(+) as coenzyme. 16-fold increase in catalytic efficiency with NAD(+) as coenzyme.
- Q214 (≠ S216) binding
- S230 (≠ D232) binding
- E251 (= E253) binding
- N286 (≠ T288) binding ; mutation to E: 4-fold increase in catalytic efficiency with L-lactaldehyde as substrate. Shows expanded substrate specificity.; mutation to H: 15-fold increase in catalytic efficiency with L-lactaldehyde as substrate. Shows expanded substrate specificity.; mutation to T: 6-fold increase in catalytic efficiency with L-lactaldehyde as substrate. Shows expanded substrate specificity.
- R336 (= R337) binding
- E443 (≠ L445) binding
- H449 (= H451) binding
O94788 Retinal dehydrogenase 2; RALDH 2; RalDH2; Aldehyde dehydrogenase family 1 member A2; ALDH1A2; Retinaldehyde-specific dehydrogenase type 2; RALDH(II); EC 1.2.1.36 from Homo sapiens (Human) (see 6 papers)
35% identity, 98% coverage: 10:484/485 of query aligns to 38:516/518 of O94788
- E50 (vs. gap) to G: in dbSNP:rs34266719
- A110 (= A78) to V: in dbSNP:rs35365164
- Q182 (≠ S151) to K: in DIH4; decreased retinoic acid biosynthetic process
- IPW 184:186 (≠ APW 153:155) binding
- KPAE 210:213 (≠ KPSE 179:182) binding
- STE 264:266 (≠ DIV 232:234) binding
- C320 (= C287) active site, Nucleophile
- R347 (≠ L314) to H: in DIH4; decreased expression; dbSNP:rs141245344
- V348 (≠ R315) to I: in dbSNP:rs4646626
- KQYNK 366:370 (≠ RQRDR 333:337) binding
- A383 (= A357) to T: in DIH4; uncertain significance; dbSNP:rs749124508
- E417 (= E385) binding
- E436 (≠ D404) to K: in dbSNP:rs34744827
- S461 (≠ A429) to Y: in DIH4; decreased retinoic acid biosynthetic process
6b5hA Aldh1a2 liganded with NAD and 1-(4-cyanophenyl)-n-(3-fluorophenyl)-3- [4-(methylsulfonyl)phenyl]-1h-pyrazole-4-carboxamide (compound cm121) (see paper)
35% identity, 98% coverage: 10:484/485 of query aligns to 12:490/492 of 6b5hA
- active site: N161 (= N156), E260 (= E253), C294 (= C287), E468 (≠ D462)
- binding 1-(4-cyanophenyl)-N-(3-fluorophenyl)-3-[4-(methylsulfonyl)phenyl]-1H-pyrazole-4-carboxamide: V112 (≠ D106), G116 (≠ A110), F162 (≠ Y157), W169 (= W164), Q284 (≠ T277), F288 (≠ Y281), T295 (= T288), N449 (≠ F443), L451 (= L445), N452 (≠ V446), F457 (≠ H451)
- binding nicotinamide-adenine-dinucleotide: I157 (= I152), I158 (≠ A153), W160 (= W155), N161 (= N156), K184 (= K179), G217 (= G211), G221 (= G215), F235 (≠ L229), T236 (= T230), G237 (= G231), S238 (≠ D232), V241 (≠ T235), E260 (= E253), L261 (= L254), C294 (= C287), F393 (= F387)
Query Sequence
>Pf6N2E2_3126 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3126
MAGMQTPLCTALLIDGELVPGAGIVEPILNPATGEVVAHIAEASTEQVEAAILAAHRAFD
GWSRTTPQQRSNLLLDIASAIEKNADELARLESLNCGKPLYLARQDDLSATVDVFRFFAG
AVRCQTGQLSGEYLPGYTSMVRRDPIGVVASIAPWNYPIMMAAWKIAPALAAGNTLVFKP
SEHTPLSILALAPTLAQILPRGVINILCGGGEGVGSHLVSHPKVRMVSLTGDIVTGQKIL
QAAAKTLKRTHLELGGKAPVIVCNDADIQAVVEGVRTYGYYNAGQDCTAACRIYAQGAIH
DRLVAELGAAVSSLRFAGKRDADNEIGPLISTRQRDRVASFVERALGQPHIERITGAAVH
SGAGFYYQPTLLAGCKQSDEIVQREVFGPVVTVTRFDELSQAVDWANDSEYGLASSVWTQ
NLDKAMQVAARLQYGCTWINSHFMLVSEMPHGGLKRSGYGKDLSSDSLQDYSVVRHIMAR
HGQHL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory