Comparing Pf6N2E2_3142 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3142 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
57% identity, 99% coverage: 1:462/469 of query aligns to 2:461/464 of 4f4fA
1kl7A Crystal structure of threonine synthase from yeast (see paper)
43% identity, 90% coverage: 3:426/469 of query aligns to 7:462/509 of 1kl7A
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
43% identity, 90% coverage: 1:423/469 of query aligns to 5:462/514 of Q42598
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
38% identity, 91% coverage: 1:428/469 of query aligns to 5:444/496 of 8g1yA
1vb3A Crystal structure of threonine synthase from escherichia coli
33% identity, 99% coverage: 1:462/469 of query aligns to 1:427/428 of 1vb3A
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
24% identity, 68% coverage: 99:419/469 of query aligns to 115:406/444 of 2c2bA
Sites not aligning to the query:
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 68% coverage: 99:419/469 of query aligns to 190:481/526 of Q9S7B5
Sites not aligning to the query:
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
29% identity, 33% coverage: 107:262/469 of query aligns to 55:193/350 of 6nmxA
Sites not aligning to the query:
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
29% identity, 33% coverage: 107:262/469 of query aligns to 53:191/345 of 6cgqB
Sites not aligning to the query:
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
30% identity, 33% coverage: 107:262/469 of query aligns to 51:183/339 of 6cgqA
Sites not aligning to the query:
>Pf6N2E2_3142 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3142
MRYISTRGQAPALNFEDVLLAGLATDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVTGSIPDADFKKILEETYGVFSHNAIAPLRQLNGNEWVMELFHGPTLAFKDFALQLLG
RLLDYVLQKRGERVVIVGATSGDTGSAAIEGCKHCENVDIFILHPHNRVSEVQRRQMTTI
FGDNIHNIAIEGNFDDCQEMVKASFADQSFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVSFSVPTGNFGDIFAGYLARNMGLPINQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDLHGRNGAAIAGLMDSFRQGGGFSVEPERWTEARKLFDS
LAVDDEQTCETIAEVFAQSGELLDPHTAIGVRAARECRRSLDIPMVILGTAHPVKFPEAV
EKAGVGKALELPAHLSDLFERDERCTVLPNDLKAVQAFVSQHGNRGKPL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory