Comparing Pf6N2E2_3172 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3172 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
27% identity, 91% coverage: 10:250/264 of query aligns to 1:242/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
27% identity, 91% coverage: 10:250/264 of query aligns to 1:242/261 of 3klcA
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
27% identity, 91% coverage: 12:252/264 of query aligns to 6:259/276 of Q9NQR4
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
27% identity, 84% coverage: 10:232/264 of query aligns to 2:227/262 of Q9UYV8
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
26% identity, 88% coverage: 10:242/264 of query aligns to 3:241/263 of 7ovgA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
26% identity, 88% coverage: 10:242/264 of query aligns to 9:247/269 of 6ypaB
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 92% coverage: 12:254/264 of query aligns to 39:299/307 of Q94JV5
Sites not aligning to the query:
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
28% identity, 89% coverage: 10:243/264 of query aligns to 10:249/263 of 4iztA
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
28% identity, 88% coverage: 10:241/264 of query aligns to 2:239/254 of 4izuA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
28% identity, 89% coverage: 10:243/264 of query aligns to 9:248/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
28% identity, 89% coverage: 10:243/264 of query aligns to 9:248/262 of 5ny7A
Sites not aligning to the query:
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
28% identity, 88% coverage: 10:241/264 of query aligns to 9:246/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
28% identity, 88% coverage: 10:241/264 of query aligns to 9:246/261 of 4izsA
5khaA Structure of glutamine-dependent NAD+ synthetase from acinetobacter baumannii in complex with adenosine diphosphate (adp)
26% identity, 75% coverage: 32:228/264 of query aligns to 22:228/526 of 5khaA
Sites not aligning to the query:
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
26% identity, 87% coverage: 3:232/264 of query aligns to 5:249/339 of O25067
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
27% identity, 69% coverage: 23:205/264 of query aligns to 21:223/301 of 5h8iC
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
27% identity, 69% coverage: 23:205/264 of query aligns to 17:219/297 of 5h8jB
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 69% coverage: 23:203/264 of query aligns to 18:226/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
27% identity, 69% coverage: 23:203/264 of query aligns to 15:223/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
27% identity, 69% coverage: 23:203/264 of query aligns to 15:223/304 of 4hg3A
>Pf6N2E2_3172 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3172
MRDLSTLPDLDIALVQTTLAWHDRRANLEHFEALLEQARGADLIILPEMFTTGFSMESET
LAEPENGPTRQWLKALAAKLDAVITGSVIIQAADGSHRNRLLWARPDGEVLHYDKRHLFR
MAGEHNHYTPGERQVLFELKGWRIRPLICYDLRFPVWSRDAEDTDLLLYTANWPGARRLH
WNRLLPARAIENLCYVAAVNRVGTDGKGFAYTGDSQVLDFQGESLLSAGEADGVFKVCLN
AADLAAYRTRFPANLDADRFEFTN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory