Comparing Pf6N2E2_318 Gluconolactonase (EC 3.1.1.17) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
36% identity, 80% coverage: 63:353/363 of query aligns to 28:296/299 of 3dr2A
3e5zA X-ray structure of the putative gluconolactonase in protein family pf08450. Northeast structural genomics consortium target drr130.
34% identity, 83% coverage: 57:359/363 of query aligns to 7:287/290 of 3e5zA
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
30% identity, 73% coverage: 80:344/363 of query aligns to 17:250/289 of 7pldB
Sites not aligning to the query:
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
30% identity, 73% coverage: 80:344/363 of query aligns to 17:250/289 of 7plbB
Sites not aligning to the query:
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
30% identity, 73% coverage: 80:344/363 of query aligns to 17:250/289 of Q9A9Z1
8dk0A Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma- valerolactone (see paper)
26% identity, 74% coverage: 67:336/363 of query aligns to 1:260/293 of 8dk0A
8djzA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound product (see paper)
26% identity, 74% coverage: 67:336/363 of query aligns to 1:260/293 of 8djzA
8djfA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound tetrahedral intermediate (see paper)
26% identity, 74% coverage: 67:336/363 of query aligns to 1:260/293 of 8djfA
7risA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate (see paper)
27% identity, 74% coverage: 69:336/363 of query aligns to 1:260/293 of 7risA
7rizA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline (see paper)
26% identity, 74% coverage: 69:336/363 of query aligns to 1:273/306 of 7rizA
2dsoC Crystal structure of d138n mutant of drp35, a 35kda drug responsive protein from staphylococcus aureus (see paper)
29% identity, 55% coverage: 128:328/363 of query aligns to 93:271/323 of 2dsoC
Sites not aligning to the query:
Q99QV3 Lactonase drp35; EC 3.1.1.- from Staphylococcus aureus (strain Mu50 / ATCC 700699) (see paper)
28% identity, 55% coverage: 128:328/363 of query aligns to 95:273/324 of Q99QV3
Sites not aligning to the query:
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
26% identity, 75% coverage: 72:345/363 of query aligns to 8:259/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
26% identity, 75% coverage: 72:345/363 of query aligns to 8:259/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
26% identity, 75% coverage: 72:345/363 of query aligns to 8:259/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
26% identity, 75% coverage: 72:345/363 of query aligns to 8:259/297 of 4gn7A
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
24% identity, 75% coverage: 72:344/363 of query aligns to 8:258/297 of 3g4hA
4gncA Human smp30/gnl-1,5-ag complex (see paper)
24% identity, 75% coverage: 72:344/363 of query aligns to 9:259/298 of 4gncA
Sites not aligning to the query:
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
24% identity, 75% coverage: 72:344/363 of query aligns to 10:260/299 of Q15493
Q9M1B4 Protein STRICTOSIDINE SYNTHASE-LIKE 13; AtSSL13; Protein LESS ADHERENT POLLEN 3; Strictosidine synthase 11; AtSS11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 25% coverage: 154:244/363 of query aligns to 181:272/403 of Q9M1B4
Sites not aligning to the query:
>Pf6N2E2_318 Gluconolactonase (EC 3.1.1.17)
MDASQSATAADQGRRVFLKKSLVVSAAAAALGNLPGLAQAEPLSQRYPDPLINILDPSFM
DLRIFNASVEKLATGLRWAEGPVWVGDGRYLLVSDIPNNRIVRWDEVTGGLSVYRENSNF
SNGMCRDRQGRLLVCEGSTTASEGRRITRTEHNGTITVLADSFEGKPLNSPNDIVCKRDG
SVWFTDPPFQTGNNYEGHKVTPAQPHAVYRIDGETGKVTRVIDDLAGPNGLCFSPDEKIL
YVVEGRAKPNRLIWAITVKDDGTLGERRKHIEGLDYAAIDGIKCDESGNLWCGWGGNGDP
KADLEKLDGVRVFNPEGKAIGHISLPERCPNVCFGGREGNRLFMAGSHSLYSLFVNTRGA
TFA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory