Comparing Pf6N2E2_3203 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3203 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
75% identity, 98% coverage: 5:294/295 of query aligns to 2:290/291 of 3na8A
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
32% identity, 98% coverage: 6:293/295 of query aligns to 2:287/292 of Q07607
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
31% identity, 97% coverage: 6:292/295 of query aligns to 2:286/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
31% identity, 97% coverage: 6:292/295 of query aligns to 2:286/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
31% identity, 97% coverage: 6:292/295 of query aligns to 2:286/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
31% identity, 97% coverage: 6:292/295 of query aligns to 2:286/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
31% identity, 97% coverage: 6:292/295 of query aligns to 2:286/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
31% identity, 97% coverage: 6:292/295 of query aligns to 2:286/291 of 3pueB
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
28% identity, 95% coverage: 14:293/295 of query aligns to 22:300/306 of 7kkdB
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
28% identity, 95% coverage: 14:293/295 of query aligns to 12:290/296 of 4m19A
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
28% identity, 95% coverage: 14:293/295 of query aligns to 12:290/296 of 6u01B
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
28% identity, 95% coverage: 14:293/295 of query aligns to 12:290/296 of 7kg2A
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
26% identity, 98% coverage: 6:293/295 of query aligns to 3:291/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
26% identity, 98% coverage: 6:293/295 of query aligns to 2:290/294 of Q9X1K9
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
31% identity, 88% coverage: 8:267/295 of query aligns to 4:263/294 of 4i7wA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
32% identity, 88% coverage: 8:266/295 of query aligns to 4:262/294 of Q8UGL3
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
29% identity, 94% coverage: 8:284/295 of query aligns to 5:285/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
29% identity, 94% coverage: 8:284/295 of query aligns to 5:285/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 94% coverage: 8:284/295 of query aligns to 5:285/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 94% coverage: 8:284/295 of query aligns to 5:285/298 of 4oe7B
>Pf6N2E2_3203 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3203
MSTPNIHGIIGYTITPFSTDGQGLDLDALGRSIDRLIDSGVHAIAPLGSTGEGAYLSDAE
WDQVSEFSIARVAGRVPTVVSVSDLTTAKAVHRARFAQAKGADVVMVLPASYWKLSEAEI
LAHYQAIGASIDLPIMLYNNPATSGIDMSVELILRIFNTVDNVTMVKESTGDIQRMHKLQ
LLGEGQVPFYNGCNPLALEAFAAGAKGWCTAAPNLIPQLNLDLYAAVLANDLSQARALFY
RQLPLLDFILKGGLPATIKAGLRTLGLEVGDPRLPVFPLDEARNQQLQTMLKQLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory