Comparing Pf6N2E2_3269 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3269 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
26% identity, 94% coverage: 2:133/140 of query aligns to 514:646/650 of O31645
Sites not aligning to the query:
>Pf6N2E2_3269 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3269
VNAPGGSKKKALEHIANLIHREVPDLEMQDVFEALVAREKLGSTGFGNGIAIPHCRLKGC
AAPISALLHLETAIDFDAIDGAPVDLLFVLLVPEAATDAHLELLRQIASMLDRKEVREKL
RSAPSNEALYQVVLDEQNGH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory