Comparing Pf6N2E2_33 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_33 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
3ekmA Crystal structure of diaminopimelate epimerase form arabidopsis thaliana in complex with irreversible inhibitor dl-azidap (see paper)
25% identity, 74% coverage: 66:313/333 of query aligns to 45:267/287 of 3ekmA
Sites not aligning to the query:
3ejxD Crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap (see paper)
25% identity, 74% coverage: 66:313/333 of query aligns to 59:281/301 of 3ejxD
Sites not aligning to the query:
2gkjA Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor dl-azidap (see paper)
25% identity, 74% coverage: 67:311/333 of query aligns to 43:252/274 of 2gkjA
Sites not aligning to the query:
2gkeA Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor ll-azidap (see paper)
25% identity, 74% coverage: 67:311/333 of query aligns to 43:252/274 of 2gkeA
Sites not aligning to the query:
P44859 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
25% identity, 74% coverage: 67:311/333 of query aligns to 43:252/274 of P44859
Sites not aligning to the query:
P0A6K1 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Escherichia coli (strain K12) (see paper)
25% identity, 74% coverage: 67:311/333 of query aligns to 43:252/274 of P0A6K1
Sites not aligning to the query:
5m47A Crystal structure of dapf from corynebacterium glutamicum in complex with d,l-diaminopimelate (see paper)
30% identity, 66% coverage: 86:304/333 of query aligns to 74:250/280 of 5m47A
Sites not aligning to the query:
Q8NP73 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025)
30% identity, 66% coverage: 86:304/333 of query aligns to 74:250/277 of Q8NP73
Sites not aligning to the query:
>Pf6N2E2_33 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_33
MTKFYDARGNIYGVISPRQVRDHGIALPQSAAQAAQTRESWATAAVHAFCAWAPGEAPPD
AKAHRSDGLLIGPFQNEPPFDLLIVNTDGTLAERSGNGLTIFSQALQEQGLMAGTGDCLL
QVHHDKPDGLSPLQTSVRAAEFEGAQGFWLDLGKPLFGPGAVGAQDVVRVMFNQCDVSRV
AALERLNPAWGNSQFVNIGNPHCVTLVDSAEALPSNPQMRAPALCQSLTRIAYAPPGGAG
MPCPMGVNLQWAWLEAEGRIAARVFERGEGPTASSGTSASAVACAAWRAGWVQAGPVSVM
MPGGLRRFCWKKRRVSGCGSGCLGRRGLCPRAF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory