SitesBLAST
Comparing Pf6N2E2_3321 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3321 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5d85A Staphyloferrin b precursor biosynthetic enzyme sbna bound to aminoacrylate intermediate (see paper)
38% identity, 89% coverage: 22:303/317 of query aligns to 25:307/313 of 5d85A
- active site: K39 (= K36), S264 (= S260)
- binding citrate anion: S67 (= S64), K92 (≠ N89), G119 (= G116), Y120 (≠ F117), L121 (= L118), R124 (= R121), R216 (= R212), A223 (≠ T219), S224 (= S220)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: K39 (= K36), T66 (≠ S63), S67 (= S64), N69 (= N66), L70 (= L67), Q143 (= Q140), V176 (≠ A172), S177 (≠ G173), T178 (= T174), T179 (= T175), S181 (≠ T177), G220 (= G216), S264 (= S260), P290 (= P286), D291 (= D287)
A6QDA0 N-(2-amino-2-carboxyethyl)-L-glutamate synthase; ACEGA synthase; Staphyloferrin B biosynthesis protein SbnA; EC 2.5.1.140 from Staphylococcus aureus (strain Newman) (see paper)
38% identity, 89% coverage: 22:303/317 of query aligns to 33:315/326 of A6QDA0
- K47 (= K36) modified: N6-(pyridoxal phosphate)lysine
- N77 (= N66) binding
- R132 (= R121) mutation to A: No detectable enzyme activity. Does not form pyridoxal 5'-phosphate-alpha-aminoacrylate reaction intermediate.
- Y152 (= Y141) mutation to F: Very low enzyme activity. Does not form pyridoxal 5'-phosphate-alpha-aminoacrylate reaction intermediate; when associated with G-185.
- STTGS 185:189 (≠ GTTGT 173:177) binding
- S272 (= S260) binding
5d84A Staphyloferrin b precursor biosynthetic enzyme sbna bound to plp (see paper)
38% identity, 89% coverage: 22:303/317 of query aligns to 27:309/318 of 5d84A
- active site: K41 (= K36), S266 (= S260)
- binding pyridoxal-5'-phosphate: K41 (= K36), N71 (= N66), V178 (≠ A172), S179 (≠ G173), T180 (= T174), T181 (= T175), S183 (≠ T177), G222 (= G216), S266 (= S260), P292 (= P286), D293 (= D287)
5d86A Staphyloferrin b precursor biosynthetic enzyme sbna y152f variant (see paper)
37% identity, 89% coverage: 22:303/317 of query aligns to 26:308/318 of 5d86A
- active site: K40 (= K36), S265 (= S260)
- binding magnesium ion: S225 (= S220), R226 (= R221)
- binding pyridoxal-5'-phosphate: K40 (= K36), N70 (= N66), V177 (≠ A172), S178 (≠ G173), T179 (= T174), T180 (= T175), S182 (≠ T177), G221 (= G216), S265 (= S260), P291 (= P286), D292 (= D287)
8if7A Crystal structure of cmnb (see paper)
36% identity, 88% coverage: 22:301/317 of query aligns to 38:317/342 of 8if7A
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: K52 (= K36), T78 (≠ S63), S79 (= S64), N81 (= N66), L82 (= L67), V188 (≠ A172), S189 (≠ G173), T190 (= T174), G191 (≠ T175), T193 (= T177), G232 (= G216), S276 (= S260), A302 (≠ P286), D303 (= D287)
4pcuA Crystal structure of delta516-525 e201s human cystathionine beta- synthase with adomet (see paper)
34% identity, 87% coverage: 25:301/317 of query aligns to 66:346/486 of 4pcuA
- active site: K77 (= K36), S105 (= S64), D237 (= D198), S305 (= S260)
- binding protoporphyrin ix containing fe: A182 (≠ P144), P185 (= P147), L186 (= L148), Y189 (= Y151), R222 (= R183), T269 (≠ E224)
- binding pyridoxal-5'-phosphate: K77 (= K36), N107 (= N66), G212 (= G173), T213 (= T174), G214 (≠ T175), T216 (= T177), G261 (= G216), S305 (= S260), P331 (= P286), D332 (= D287)
Sites not aligning to the query:
- binding protoporphyrin ix containing fe: 8, 9, 10, 11, 12, 20, 21, 22, 23
- binding s-adenosylmethionine: 376, 396, 397, 398, 399, 476, 478, 479
7qgtB Crystal structure of human cystathionine beta-synthase (delta516-525) in complex with aoaa. (see paper)
33% identity, 87% coverage: 25:301/317 of query aligns to 68:350/500 of 7qgtB
- binding protoporphyrin ix containing fe: A186 (≠ P144), P189 (= P147), L190 (= L148), Y193 (= Y151), R226 (= R183)
- binding 4'-deoxy-4'-acetylyamino-pyridoxal-5'-phosphate: K79 (= K36), T106 (≠ S63), S107 (= S64), N109 (= N66), T110 (≠ L67), Q182 (= Q140), G216 (= G173), T217 (= T174), G218 (≠ T175), T220 (= T177), G265 (= G216), S309 (= S260), P335 (= P286), D336 (= D287)
Sites not aligning to the query:
7qgtA Crystal structure of human cystathionine beta-synthase (delta516-525) in complex with aoaa. (see paper)
33% identity, 87% coverage: 25:301/317 of query aligns to 68:350/500 of 7qgtA
- binding protoporphyrin ix containing fe: A186 (≠ P144), P189 (= P147), L190 (= L148), Y193 (= Y151), R226 (= R183)
- binding pyridoxal-5'-phosphate: K79 (= K36), N109 (= N66), G216 (= G173), T217 (= T174), G218 (≠ T175), T220 (= T177), G265 (= G216), S309 (= S260), P335 (= P286), D336 (= D287)
Sites not aligning to the query:
P16703 Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 from Escherichia coli (strain K12) (see paper)
37% identity, 86% coverage: 22:295/317 of query aligns to 27:289/303 of P16703
- N71 (= N66) binding
- S255 (= S260) binding
P35520 Cystathionine beta-synthase; Beta-thionase; Serine sulfhydrase; EC 4.2.1.22 from Homo sapiens (Human) (see 40 papers)
33% identity, 87% coverage: 25:301/317 of query aligns to 108:390/551 of P35520
- C109 (≠ I26) to R: in CBSD; loss of activity; dbSNP:rs778220779
- A114 (≠ P31) to V: in CBSD; mild form; when linked with W-58 severe form; decreased cystathionine beta-synthase activity; decreases homotetramer formation by promoting formation of larger aggregates; dbSNP:rs121964964
- K119 (= K36) modified: N6-(pyridoxal phosphate)lysine
- R125 (≠ S42) to Q: in CBSD; severe form; when linked with D-131 moderate form; loss of cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs781444670; to W: in CBSD; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure; dbSNP:rs886057100
- M126 (≠ L43) to V: in CBSD; loss of activity
- E131 (= E48) to D: in CBSD; linked with Q-125; loss of activity; dbSNP:rs1555875351
- G139 (= G56) to R: in CBSD; mild form; dbSNP:rs121964965
- I143 (= I60) to M: in CBSD; 4% of activity; stable; dbSNP:rs370167302
- E144 (= E61) to K: in CBSD; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; decreased homotetramer formation; dbSNP:rs121964966
- G148 (= G65) to R: in CBSD; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; loss of homotetramer formation; dbSNP:rs755952006
- N149 (= N66) binding
- L154 (= L71) to Q: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity
- A155 (≠ S72) to T: in CBSD; complete loss of activity; severely affects homotetramer formation by promoting formation of larger aggregates; dbSNP:rs1429138569; to V: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity
- C165 (≠ F82) to Y: in CBSD; severe form; protein expression is comparable to wild-type; loss of cystathionine beta-synthase activity; no effect on homotetramer formation; dbSNP:rs1347651454
- M173 (≠ V90) to V: in CBSD; presents 40% of the wild-type activity; highly reduced capacity to form multimeric quaternary structure; natural variant: Missing (in CBSD; loss of activity)
- E176 (≠ V93) to K: in CBSD; severe form; loss of cystathionine beta-synthase activity; inhibited by AdoMet; severely decreases homotetramer formation by promoting formation of larger aggregates; dbSNP:rs762065361
- V180 (≠ L97) to A: in CBSD; decreased cystathionine beta-synthase activity; decreases homotetramer formation; dbSNP:rs1555875010
- T191 (≠ C108) to M: in CBSD; moderate and severe forms; loss of cystathionine beta-synthase activity; absent capacity to form multimeric quaternary structure; dbSNP:rs121964973
- K211 (≠ I125) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
- A226 (≠ P144) to T: in CBSD; presents 20% of the wild-type activity; dramatically reduced capacity to form multimeric quaternary structure; dbSNP:rs763835246
- N228 (= N146) to K: in CBSD; loss of cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs1464223176; to S: in CBSD; has significantly decreased levels of enzyme activity; dbSNP:rs1555874803
- A231 (= A149) to P: in CBSD; has significantly decreased levels of enzyme activity
- D234 (≠ N152) to N: in CBSD; decreased cystathionine beta-synthase activity; changed localization; decreased interaction with pyridoxal 5'-phosphate; no effect on homotetramer formation; dbSNP:rs773734233; natural variant: Missing (in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity)
- GTGGT 256:260 (≠ GTTGT 173:177) binding
- T257 (= T174) to M: in CBSD; moderate to severe form; protein expression is comparable to wild-type; significant decrease of enzyme activity; dbSNP:rs758236584
- T262 (≠ I179) to M: in CBSD; moderate form; dbSNP:rs149119723; to R: in CBSD; severe form; loss of cystathionine beta-synthase activity; loss of homotetramer formation
- R266 (= R183) to K: in CBSD; mild form; decreased cystathionine beta-synthase activity; decreased homotetramer formation; no effect on heme-binding; decreased stability; dbSNP:rs121964969
- K269 (≠ R186) natural variant: Missing (in CBSD; loss of expression)
- C272 (≠ A189) mutation to A: Reduced heme content and cystathionine beta-synthase activity.
- C275 (≠ V192) to Y: in CBSD; severe form; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure; mutation to S: Reduced heme content and cystathionine beta-synthase activity.
- I278 (= I195) to S: in CBSD; loss of activity; to T: in CBSD; mild to severe form; common mutation; decreased expression; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; severely affects homotetramer formation by promoting formation of larger aggregates; dbSNP:rs5742905
- D281 (= D198) to N: in CBSD; loss of activity
- A288 (vs. gap) to T: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity; dbSNP:rs141502207
- E302 (vs. gap) to K: in CBSD; no effect on cystathionine beta-synthase activity; inhibited by AdoHcy and impaired activation by AdoMet; no effect on homotetramer formation; dbSNP:rs779270933
- G305 (= G216) to R: in CBSD; loss of cystathionine beta-synthase activity; no effect on homotetramer formation
- G307 (= G218) to S: in CBSD; moderate to severe form; linked with D-534; common mutation; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; no effect on homotetramer formation; dbSNP:rs121964962
- V320 (= V231) to A: in CBSD; has 36% of wild-type enzyme activity; dbSNP:rs781567152
- D321 (≠ E232) to V: in CBSD; loss of activity
- R336 (= R247) to C: in CBSD; protein expression is comparable to wild-type; loss of activity; absent capacity to form multimeric quaternary structure; dbSNP:rs398123151; to H: in CBSD; mild form; no effect on expression; exhibits an activity lower than 4% of the wild-type enzyme; altered stimulation by AdoMet; absent capacity to form multimeric quaternary structure; dbSNP:rs760417941
- L338 (≠ V249) to P: in CBSD; severe form; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure
- G347 (= G258) to S: in CBSD; protein expression is comparable to wild-type; loss of activity; dbSNP:rs771298943
- S349 (= S260) binding ; to N: in CBSD; severe form; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure
- T353 (≠ V264) to M: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity; dbSNP:rs121964972
- R369 (≠ E280) to C: in CBSD; when linked with C-491 severe form; decreased cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs117687681
- D376 (= D287) to N: in CBSD; has significantly decreased levels of enzyme activity; dbSNP:rs1170128038
- R379 (≠ E290) to Q: in CBSD; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure; dbSNP:rs763036586
- K384 (≠ T295) to E: in CBSD; severe form; dbSNP:rs121964967
Sites not aligning to the query:
- 18 R → C: results in 1/3 to 2/3 the enzyme activity of the wild-type; dbSNP:rs201827340
- 49 P → L: in CBSD; decreased expression; no effect on cystathionine beta-synthase activity; increased homotetramer formation; dbSNP:rs148865119
- 52 binding axial binding residue
- 58 R → W: in CBSD; linked with V-114; 18% of activity; dbSNP:rs555959266
- 65 binding axial binding residue; H → R: in CBSD; decreased cystathionine beta-synthase activity; inhibited by AdoMet and AdoHcy; decreased homotetramer formation; dbSNP:rs1191141364
- 69 A → P: in dbSNP:rs17849313
- 78 P → R: in CBSD; severe form; associated in cis with N-102; decreased cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs786204608
- 85 G → R: in CBSD; loss of cystathionine beta-synthase activity; dbSNP:rs863223435
- 87 T → N: in CBSD; decreased cystathionine beta-synthase activity; increased aggregation
- 101 L → P: in CBSD; common mutation in Irish population; loss of activity; dbSNP:rs786204757
- 102 K → N: in CBSD; associated in cis with R-78; decreased cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs786204609; K → Q: in dbSNP:rs34040148
- 422 P → L: in CBSD; changed cystathionine beta-synthase activity; impaired stimulation by AdoMet; does not affect homotetramer formation; dbSNP:rs28934892
- 427 P → L: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet; dbSNP:rs863223434
- 435 I → T: in CBSD; no effect on cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; does not affect homotetramer formation
- 439 R → Q: in CBSD; no effect on cystathionine beta-synthase activity; increased homotetramer formation; dbSNP:rs756467921
- 444 D → N: in CBSD; decreased expression; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet; increased homotetramer formation; dbSNP:rs28934891
- 449 V → G: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet
- 456 L → P: in CBSD; severe; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure
- 466 S → L: in CBSD; increased cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; decreased homotetramer formation; dbSNP:rs121964971
- 500 S → L: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet; dbSNP:rs755106884
- 526 Q → K: in CBSD; has significantly decreased levels of enzyme activity
- 539 L → S: in CBSD; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; loss of homotetramer formation; dbSNP:rs121964968
- 540 L → Q: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet
- 548 R → Q: presents 60% of the wild-type activity; highly reduced capacity to form multimeric quaternary structure; dbSNP:rs150828989
5ohxA Structure of active cystathionine b-synthase from apis mellifera (see paper)
36% identity, 88% coverage: 22:301/317 of query aligns to 60:341/488 of 5ohxA
- binding protoporphyrin ix containing fe: P181 (= P144), P184 (= P147), Y188 (= Y151), R221 (= R183)
- binding pyridoxal-5'-phosphate: K74 (= K36), N104 (= N66), G209 (= G171), G211 (= G173), T212 (= T174), G213 (≠ T175), G214 (= G176), T215 (= T177), G256 (= G216), S300 (= S260), P326 (= P286), D327 (= D287)
Sites not aligning to the query:
Q2V0C9 Cystathionine beta-synthase; EC 4.2.1.22 from Apis mellifera (Honeybee) (see paper)
35% identity, 89% coverage: 22:304/317 of query aligns to 64:351/504 of Q2V0C9
- K78 (= K36) modified: N6-(pyridoxal phosphate)lysine
- N108 (= N66) binding
- GTGGT 215:219 (≠ GTTGT 173:177) binding
- S307 (= S260) binding
Sites not aligning to the query:
- 12 binding axial binding residue
- 23 binding axial binding residue
6ahiB Crystal structure of o-acetylserine dependent cystathionine beta- synthase from helicobacter pylori. (see paper)
33% identity, 86% coverage: 22:293/317 of query aligns to 32:300/306 of 6ahiB
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 88% coverage: 22:299/317 of query aligns to 30:307/310 of P9WP55
- K44 (= K36) modified: N6-(pyridoxal phosphate)lysine
- N74 (= N66) binding
- GTGGT 178:182 (≠ GTTGT 173:177) binding
- S266 (= S260) binding
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
35% identity, 86% coverage: 22:295/317 of query aligns to 30:302/306 of 2q3dA
- active site: K44 (= K36), S266 (= S260), P293 (= P286)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl)-amino]-propionic acid: K44 (= K36), T71 (≠ S63), S72 (= S64), N74 (= N66), T75 (≠ L67), Q144 (= Q140), V177 (≠ A172), G178 (= G173), T179 (= T174), G180 (≠ T175), T182 (= T177), G222 (= G216), I223 (≠ L217), S266 (= S260), P293 (= P286), D294 (= D287)
Q79FV4 S-sulfocysteine synthase; O-phospho-L-serine-dependent S-sulfocysteine synthase; OPS-dependent S-sulfocysteine synthase; O-phosphoserine sulfhydrylase; EC 2.8.5.1; EC 2.5.1.65 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 89% coverage: 23:303/317 of query aligns to 53:331/372 of Q79FV4
- R243 (≠ P215) mutation to A: 10-fold decrease in the specificity constant for thiosulfate compared to wild-type enzyme but little change in the specificity constant for the substrate OPS.
3zeiA Structure of the mycobacterium tuberculosis o-acetylserine sulfhydrylase (oass) cysk1 in complex with a small molecule inhibitor (see paper)
35% identity, 86% coverage: 22:293/317 of query aligns to 30:300/300 of 3zeiA
- active site: K44 (= K36), S266 (= S260), P293 (= P286)
- binding 3-[(Z)-[(5Z)-5-[[2-(2-hydroxy-2-oxoethyloxy)phenyl]methylidene]-3-methyl-4-oxidanylidene-1,3-thiazolidin-2-ylidene]amino]benzoic acid: T71 (≠ S63), S72 (= S64), I126 (= I122), Q144 (= Q140), F145 (≠ Y141), K215 (≠ E207), G222 (= G216), A225 (≠ T219), F227 (≠ R221)
- binding pyridoxal-5'-phosphate: K44 (= K36), N74 (= N66), V177 (≠ A172), G178 (= G173), T179 (= T174), G180 (≠ T175), T182 (= T177), G222 (= G216), S266 (= S260), P293 (= P286), D294 (= D287)
2q3cA 2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi (see paper)
35% identity, 86% coverage: 22:293/317 of query aligns to 30:300/300 of 2q3cA
- active site: K44 (= K36), S266 (= S260), P293 (= P286)
- binding : T71 (≠ S63), S72 (= S64), G73 (= G65), T75 (≠ L67), M122 (≠ F117), Q144 (= Q140), K215 (≠ E207), G222 (= G216), A225 (≠ T219)
2efyA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-acetylbutyric acid
35% identity, 86% coverage: 22:295/317 of query aligns to 26:298/302 of 2efyA
- active site: K40 (= K36), S70 (= S64), E200 (≠ D198), S204 (vs. gap), S263 (= S260)
- binding 5-oxohexanoic acid: T69 (≠ S63), G71 (= G65), T73 (≠ L67), Q141 (= Q140), G175 (= G173), G219 (= G216), M220 (≠ L217), P222 (≠ T219)
- binding pyridoxal-5'-phosphate: K40 (= K36), N72 (= N66), Y172 (vs. gap), G175 (= G173), T176 (= T174), G177 (≠ T175), T179 (= T177), G219 (= G216), S263 (= S260), P289 (= P286), D290 (= D287)
2ecqA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 3-hydroxylactate
35% identity, 86% coverage: 22:295/317 of query aligns to 26:298/302 of 2ecqA
- active site: K40 (= K36), S70 (= S64), E200 (≠ D198), S204 (vs. gap), S263 (= S260)
- binding (3s)-3-hydroxybutanoic acid: K40 (= K36), G71 (= G65), T73 (≠ L67), Q141 (= Q140), G219 (= G216)
- binding pyridoxal-5'-phosphate: K40 (= K36), N72 (= N66), Y172 (vs. gap), G173 (= G171), G175 (= G173), T176 (= T174), T179 (= T177), G219 (= G216), S263 (= S260), P289 (= P286)
Query Sequence
>Pf6N2E2_3321 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3321
MMQIYSANQYHKLANFIGDVPVYLKIEGLNPAGSIKLKTAISLIEESERLGLLSPGRKVI
ESSSGNLGVALSMICAQRGYPFTCITDPNVNQVSVNLMKAYGAEVIVCDTRDRNGGFLGA
RITLIQEMIRQDPRYFWTNQYANPANPLAHYNRTAPEILQQHPNCKWLFVGAGTTGTLIG
CARYLREKAPEVKLIAVDTVGSINFQEVPKKRLIPGLGTSRRPEILERDLVEHIEFVDEV
ETIRMCRSVAQDYGLLLGGSTGTVLVAVKRLRKQIPAGDEVVVISPDMGERYLETIYSDK
WCDANFGSQMYQHAMVG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory