SitesBLAST
Comparing Pf6N2E2_3333 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3333 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
42% identity, 61% coverage: 8:240/385 of query aligns to 30:263/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
42% identity, 61% coverage: 8:240/385 of query aligns to 30:263/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
41% identity, 60% coverage: 8:237/385 of query aligns to 30:260/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ D17), S61 (= S40), G62 (= G41), G64 (= G43), K65 (= K44), S66 (= S45), T67 (= T46), Q111 (= Q86), K161 (≠ R138), Q162 (≠ E139), S164 (= S141), G166 (= G143), M167 (≠ Q144), Q188 (≠ E165), H221 (= H198)
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 62% coverage: 2:241/385 of query aligns to 7:244/375 of 2d62A
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
38% identity, 62% coverage: 2:241/385 of query aligns to 3:234/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
38% identity, 62% coverage: 2:241/385 of query aligns to 3:234/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F11), S37 (= S40), G38 (= G41), C39 (= C42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (= T46), Q81 (= Q86), R128 (= R135), A132 (≠ E139), S134 (= S141), G136 (= G143), Q137 (= Q144), E158 (= E165), H191 (= H198)
- binding magnesium ion: S42 (= S45), Q81 (= Q86)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
38% identity, 62% coverage: 2:241/385 of query aligns to 3:234/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F11), G38 (= G41), C39 (= C42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (= T46), R128 (= R135), S134 (= S141), Q137 (= Q144)
- binding beryllium trifluoride ion: S37 (= S40), G38 (= G41), K41 (= K44), Q81 (= Q86), S134 (= S141), G136 (= G143), H191 (= H198)
- binding magnesium ion: S42 (= S45), Q81 (= Q86)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
38% identity, 62% coverage: 2:241/385 of query aligns to 3:234/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F11), V17 (≠ K19), G38 (= G41), C39 (= C42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (= T46), R128 (= R135), A132 (≠ E139), S134 (= S141), Q137 (= Q144)
- binding tetrafluoroaluminate ion: S37 (= S40), G38 (= G41), K41 (= K44), Q81 (= Q86), S134 (= S141), G135 (= G142), G136 (= G143), E158 (= E165), H191 (= H198)
- binding magnesium ion: S42 (= S45), Q81 (= Q86)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
38% identity, 62% coverage: 2:241/385 of query aligns to 3:234/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F11), V17 (≠ K19), G38 (= G41), C39 (= C42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (= T46), R128 (= R135), A132 (≠ E139), S134 (= S141), Q137 (= Q144)
- binding magnesium ion: S42 (= S45), Q81 (= Q86)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
38% identity, 62% coverage: 2:241/385 of query aligns to 4:235/371 of P68187
- A85 (≠ G89) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ D110) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A118) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ L121) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ S123) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ K130) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G143) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D164) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ E234) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
38% identity, 62% coverage: 2:241/385 of query aligns to 1:232/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F11), S35 (= S40), G36 (= G41), C37 (= C42), G38 (= G43), K39 (= K44), S40 (= S45), T41 (= T46), R126 (= R135), A130 (≠ E139), S132 (= S141), G134 (= G143), Q135 (= Q144)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 63% coverage: 1:242/385 of query aligns to 17:250/378 of P69874
- C26 (≠ T10) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F11) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ I33) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C42) mutation to T: Loss of ATPase activity and transport.
- L60 (= L48) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I64) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ I125) mutation to M: Loss of ATPase activity and transport.
- D172 (= D164) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 62% coverage: 2:241/385 of query aligns to 4:235/369 of P19566
- L86 (= L90) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P166) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D171) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
39% identity, 62% coverage: 2:241/385 of query aligns to 7:230/353 of 1vciA
1g291 Malk (see paper)
37% identity, 62% coverage: 2:241/385 of query aligns to 4:241/372 of 1g291
- binding magnesium ion: D69 (≠ E67), E71 (≠ T69), K72 (≠ T70), K79 (≠ L77), D80 (≠ R78)
- binding pyrophosphate 2-: S38 (= S40), G39 (= G41), C40 (= C42), G41 (= G43), K42 (= K44), T43 (≠ S45), T44 (= T46)
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
35% identity, 64% coverage: 1:247/385 of query aligns to 1:235/348 of 3d31A
Sites not aligning to the query:
Q99758 Phospholipid-transporting ATPase ABCA3; ABC-C transporter; ATP-binding cassette sub-family A member 3; ATP-binding cassette transporter 3; ATP-binding cassette 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Homo sapiens (Human) (see 15 papers)
37% identity, 57% coverage: 2:221/385 of query aligns to 530:744/1704 of Q99758
- N568 (≠ S40) to D: in SMDP3; does not affect location in intracellular vesicle membrane; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; does not affect protein expression; does not affect multivesicular bodies and lamellar bodies location; affects multivesicular bodies and lamellar bodies development; loss of phosphatidylcholine transport; does not affect cholesterol transport; dbSNP:rs121909184
- L579 (≠ I51) to P: in SMDP3; uncertain significance
- R605 (= R78) to Q: in SMDP3; uncertain significance; dbSNP:rs760006956
- S693 (≠ G168) mutation to L: Does not affect protein oligomerization.
Sites not aligning to the query:
- 43 R → L: in SMDP3; uncertain significance
- 53 N→Q: Does not affect N-glycosylation. Does not affect protein expression. Does not affect lamellar body membrane location.
- 101 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; dbSNP:rs121909182
- 124 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Loss of N-glycosylation. Reduces protein expression by 50%. Affects anterograde trafficking; when associated with Q-140. Reduces protein expression by 85%; when associated with Q-140. Does not affect lamellar body membrane location.
- 140 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N → H: in dbSNP:rs45447801; N→Q: Loss of N-glycosylation. Reduces protein expression by 50%. Affects anterograde trafficking; when associated with Q-124. Reduces protein expression by 85%; when associated with Q-140. Does not affect lamellar body membrane location.
- 173:174 LK→AA: Loss of proteolytic processing.
- 174:175 Cleavage; by CTSL
- 215 Q → K: in SMDP3; loss of lamellar bodies membrane location; loss of proteolytic cleavage; increases cellular free cholesterol and phosphatidylcholine transport; loss of vesicles formation; increases free cholesterol induced cell death; loss of protein oligomerization; dbSNP:rs879159551
- 280 R → C: in SMDP3; uncertain significance; does not affect protein oligomerization; dbSNP:rs201299260
- 288 R → K: in SMDP3; uncertain significance; does not affect protein oligomerization; dbSNP:rs117603931
- 290 L → M: in a breast cancer sample; somatic mutation
- 292 E → V: in SMDP3; uncertain significance; does not affect lamellar bodies membrane location; does not affect proteolytic cleavage; affects lamellar bodies formation; does not affect cholesterol and phosphatidylcholine transport; decreases vesicles formation; does not affect free cholesterol induced cell death; dbSNP:rs149989682
- 766 P → S: in dbSNP:rs45592239
- 801 E → D: in a breast cancer sample; somatic mutation
- 945 N→Q: Does not affect lamellar body membrane location. Does not affect protein expression. Does not affect proteolytic processing.
- 982 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs1402761450
- 1069 H → Q: in a breast cancer sample; somatic mutation
- 1076 N → K: in SMDP3; uncertain significance
- 1221 G → S: in SMDP3; does not affect intracellular vesicle membrane location; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; G→A: Decreases ATP hydrolysis activity of 15% compared to the wild-type.; G→T: Decreases ATP hydrolysis activity of 36% compared to the wild-type.; G→V: Decreases ATP hydrolysis activity of 18% compared to the wild-type.
- 1302 G → E: in SMDP3; uncertain significance
- 1388 K → N: in SMDP3; decreases phosphatidylcholine transport; increases protein abundance; does not affect folding in the endoplasmic reticulum; decreases proteolytic processing; affects lamellar bodies development; reduces free cholesterol transport
- 1553 L → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs121909183
- 1580 L → P: in SMDP3; does not affect location in intracellular vesicle membrane; does not affect proteolytic cleavage; does not affect N-glycosylation; loss of ATP hydrolysis activity; decreases ATP binding in vitro; affects the intracellular vesicles development; decreases phosphatidylcholine transport; L→A: Decreases ATP hydrolysis activity of 13% compared to the wild-type.; L→F: Decreases ATP hydrolysis activity of 13% compared to the wild-type.; L→V: Decreases ATP hydrolysis activity of 56% compared to the wild-type.
- 1591 Q → P: in SMDP3; loss of intracellular vesicle membrane location; loss of proteolytic cleavage; does not affect N-glycosylation; dbSNP:rs28936691
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 62% coverage: 1:240/385 of query aligns to 2:236/241 of 4u00A
7w02A Cryo-em structure of atp-bound abca3 (see paper)
37% identity, 57% coverage: 2:221/385 of query aligns to 495:709/1566 of 7w02A
- binding adenosine-5'-triphosphate: F504 (= F11), N533 (≠ S40), G534 (= G41), G536 (= G43), K537 (= K44), T538 (≠ S45), T539 (= T46), Q578 (= Q86), L630 (= L140), S631 (= S141)
- binding magnesium ion: T538 (≠ S45), Q578 (= Q86)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 1277, 1305, 1306, 1307, 1308, 1309, 1310, 1344, 1395, 1398
- binding magnesium ion: 1310, 1344
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 74% coverage: 1:286/385 of query aligns to 1:292/343 of P30750
- 40:46 (vs. 40:46, 86% identical) binding
- E166 (= E165) mutation to Q: Exhibits little ATPase activity.
- VDAPLL 278:283 (≠ EALELM 272:277) binding
Sites not aligning to the query:
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
Query Sequence
>Pf6N2E2_3333 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3333
MIELQNLSKTFKSNGKDVKAVDSVNLTVNEGEICVFLGPSGCGKSTTLKMINRLIPPTSG
KVLINGEDTTGLDEVTLRRNIGYVIQQIGLFPNMTIEENITVVPRLLGWDKQKCHDRARE
LMSMIKLEPKQYLHRYPRELSGGQQQRIGVIRALAADAPLLLMDEPFGAVDPINREMIQN
EFFEMQRALNKTVIMVSHDIDEAIKLGDKIAIFRAGKLVQCDHPDTLLAHPADEFVSSFV
GQDSTLKRLLLVKAEDAADNAPSVSPETPVNEALELMDEHDRRYVVVTCAENKALGYVRR
RDLYRQTGTCGQYLREFNATAAYDEHLRILLSRMYEFNRSWLPVMDAERVFLGEVTQESI
AEYLSSGRSRGGKTSIVSPAETALA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory