SitesBLAST
Comparing Pf6N2E2_3402 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3402 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
24% identity, 96% coverage: 1:393/410 of query aligns to 1:339/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G7), G9 (= G9), I10 (= I10), D30 (= D30), N32 (≠ A32), H33 (≠ G33), K36 (≠ A39), A37 (≠ S40), T38 (≠ A41), A40 (≠ N43), G41 (= G44), A42 (= A45), G43 (≠ Q46), V44 (≠ L47), Y174 (≠ V225), A203 (= A259), W206 (≠ Y262), I210 (≠ L266), Y250 (≠ T306), G305 (= G360), R307 (= R362), G333 (= G387), A334 (= A388), S335 (≠ L389), G336 (= G390), L337 (≠ M391), T338 (= T392)
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
27% identity, 48% coverage: 208:405/410 of query aligns to 179:371/404 of 3ad8B
- active site: G326 (= G360), K358 (≠ T392)
- binding flavin-adenine dinucleotide: V196 (= V225), G225 (≠ A259), A226 (≠ G260), H228 (≠ Y262), L247 (= L279), G353 (= G387), T354 (≠ A388), G355 (≠ L389), G356 (= G390), F357 (≠ M391), K358 (≠ T392)
- binding flavin mononucleotide: V251 (≠ S283), E279 (≠ D313), R322 (≠ Q356), W324 (= W358)
- binding pyrrole-2-carboxylate: M264 (≠ V299), Y271 (≠ T306), T354 (≠ A388), K358 (≠ T392)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
27% identity, 48% coverage: 208:405/410 of query aligns to 179:371/404 of 3ad7B
- active site: G326 (= G360), K358 (≠ T392)
- binding flavin-adenine dinucleotide: V196 (= V225), G225 (≠ A259), A226 (≠ G260), H228 (≠ Y262), L247 (= L279), G353 (= G387), T354 (≠ A388), G355 (≠ L389), G356 (= G390), F357 (≠ M391), K358 (≠ T392)
- binding flavin mononucleotide: V251 (≠ S283), K277 (≠ I311), E279 (≠ D313), R322 (≠ Q356), W324 (= W358)
- binding [methylthio]acetate: M264 (≠ V299), Y271 (≠ T306), T354 (≠ A388), K358 (≠ T392)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding [methylthio]acetate: 67, 69, 402
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
27% identity, 48% coverage: 208:405/410 of query aligns to 180:372/405 of Q50LF2
- V197 (= V225) binding
- H270 (≠ R304) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ T306) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G387) binding
- G357 (= G390) binding
- K359 (≠ T392) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
- 172 K→A: Retains 39% of wild-type activity.; K→D: Retains 32% of wild-type activity.; K→R: Retains 58% of wild-type activity.
- 173 modified: Tele-8alpha-FMN histidine
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
27% identity, 48% coverage: 208:405/410 of query aligns to 179:371/402 of 1vrqB
- active site: G326 (= G360), K358 (≠ T392)
- binding n,n-dimethylglycine: K358 (≠ T392)
- binding flavin-adenine dinucleotide: V196 (= V225), A224 (= A258), G225 (≠ A259), H228 (≠ Y262), L247 (= L279), G353 (= G387), T354 (≠ A388), G355 (≠ L389), G356 (= G390), F357 (≠ M391), K358 (≠ T392)
- binding flavin mononucleotide: V251 (≠ S283), E279 (≠ D313), R322 (≠ Q356), W324 (= W358)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
26% identity, 48% coverage: 208:405/410 of query aligns to 180:372/405 of P40875
- C195 (≠ S223) mutation to S: No change in activity.
- C351 (= C384) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
- 146 C→S: No change in activity.
- 173 modified: Tele-8alpha-FMN histidine; H→N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- 175 H→A: No effect on FMN binding and activity.
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
25% identity, 48% coverage: 208:405/410 of query aligns to 178:370/403 of 2gagB
- binding flavin-adenine dinucleotide: V195 (= V225), G224 (≠ A259), A225 (≠ G260), H227 (≠ Y262), L231 (= L266), L246 (= L279), G352 (= G387), T353 (≠ A388), G354 (≠ L389), G355 (= G390), F356 (≠ M391), K357 (≠ T392)
- binding flavin mononucleotide: V250 (≠ S283), E278 (≠ D313), R321 (≠ Q356), W323 (= W358)
- binding 2-furoic acid: M263 (≠ V299), Y270 (≠ T306), K357 (≠ T392)
- binding sulfite ion: K276 (≠ I311)
Sites not aligning to the query:
- active site: 61, 64, 65
- binding flavin-adenine dinucleotide: 26, 28, 29, 30, 51, 52, 58, 59, 60, 62, 63, 64, 66
- binding flavin mononucleotide: 61, 62, 171
- binding 2-furoic acid: 64, 66, 68, 401
- binding sulfite ion: 170
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
23% identity, 48% coverage: 123:317/410 of query aligns to 74:267/828 of 1pj6A
Sites not aligning to the query:
- active site: 550
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 331, 332, 358, 359, 360, 361
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
23% identity, 48% coverage: 123:317/410 of query aligns to 73:266/827 of 1pj7A
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 331, 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
23% identity, 48% coverage: 123:317/410 of query aligns to 73:266/827 of 3gsiA
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
23% identity, 48% coverage: 123:317/410 of query aligns to 76:269/830 of Q9AGP8
- V174 (= V225) binding
- H225 (≠ K280) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (≠ F308) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 360:363 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
Query Sequence
>Pf6N2E2_3402 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3402
MEICVVGAGIVGLSSAWFLHKAGHTVTVIDRAGEAGMGASAANGAQLSYSYVQPLADPSL
LPGIPKMLLERNGPLKFSPQWSLEQWRWCVEFLAACRTSVSRQTTVELLELAHESRLALD
AFISQEKVQCDFARTGKLVLYPDAESLRKAGDQVKFQAAQGARQQKIVSPAEALSIEPAL
EGYKKAFHGAIHTDSECAVDGRKLCQELARLLSTQGVRFLFDSEVAAFRRERGRITALEI
HHAIEGPGLLGTQAVVLAAGAYSAGLLSAFGVRMPVYPLKGYSITLPITDSMNAPTVSVT
DMRRKTVFARIGDRLRVAGMVELCGLDASIPVKRIEQLKASTQALFGLEWNADDCQPWTG
WRPATPTGRPILAVSGCDNLYVNCGQGALGMTLAFGSAQRLVRLIGGTAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory