Comparing Pf6N2E2_3425 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
40% identity, 97% coverage: 4:322/328 of query aligns to 2:325/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 96% coverage: 5:319/328 of query aligns to 4:317/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 96% coverage: 5:319/328 of query aligns to 3:306/310 of 4fwiB
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
36% identity, 78% coverage: 4:259/328 of query aligns to 2:246/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 78% coverage: 4:259/328 of query aligns to 2:246/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 78% coverage: 4:259/328 of query aligns to 2:246/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 77% coverage: 5:257/328 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 77% coverage: 5:257/328 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 77% coverage: 5:257/328 of query aligns to 2:242/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 77% coverage: 5:257/328 of query aligns to 2:242/344 of 6cvlD
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
31% identity, 70% coverage: 29:258/328 of query aligns to 46:264/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
31% identity, 70% coverage: 29:258/328 of query aligns to 46:264/382 of 7aheC
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 70% coverage: 28:257/328 of query aligns to 21:236/241 of 4u00A
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
35% identity, 67% coverage: 3:222/328 of query aligns to 2:209/648 of P75831
7ahdC Opua (e190q) occluded (see paper)
32% identity, 69% coverage: 28:252/328 of query aligns to 45:258/260 of 7ahdC
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 70% coverage: 28:257/328 of query aligns to 22:238/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 70% coverage: 28:257/328 of query aligns to 22:238/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 70% coverage: 28:257/328 of query aligns to 22:238/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 70% coverage: 28:257/328 of query aligns to 22:238/242 of 2oljA
Sites not aligning to the query:
8g4cB Bceabs atpgs high res tm (see paper)
33% identity, 65% coverage: 28:241/328 of query aligns to 26:227/248 of 8g4cB
Sites not aligning to the query:
>Pf6N2E2_3425 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3425
MSTPVLHVEDLSVIAGHGEDEVTLVDRVSFDLAKGEILGLVGESGSGKTMACRALMRLLP
SANLRVQGKALRLAGEDLLSLDEAGMRGIRGRRLGMIFQNPGSHLDPLMRIGEQIGEGIR
LHQGASKREARAKAIDVLRQVGIPDPLTRVDSYPHEFSGGMRQRAMIAVALGCNPQVLIA
DEPTTALDVTVQAQILRLLLDLRDQRGLSIIMITHDLGIVAQTCDSIAVMYAGRLCEHGN
KLDLLAHPRHPYTAALIDCQPATSAGHAMLKTIAGQPPLLDALPSGCRFNPRCLQQGSQC
TRLLPQMQVTAEAHRVACHYPLPVGASS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory