Comparing Pf6N2E2_3463 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3463 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
96% identity, 96% coverage: 17:455/456 of query aligns to 2:440/441 of 3a8uX
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
79% identity, 98% coverage: 8:455/456 of query aligns to 1:447/448 of Q9I700
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
80% identity, 97% coverage: 15:455/456 of query aligns to 1:440/441 of 4b98A
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
80% identity, 95% coverage: 22:453/456 of query aligns to 2:432/435 of 4uhmA
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
49% identity, 95% coverage: 24:456/456 of query aligns to 9:439/439 of Q9A3Q9
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
35% identity, 94% coverage: 30:456/456 of query aligns to 14:439/443 of 6fyqA
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
37% identity, 81% coverage: 28:396/456 of query aligns to 11:381/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
37% identity, 81% coverage: 28:396/456 of query aligns to 13:383/449 of 5lh9D
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
34% identity, 94% coverage: 27:455/456 of query aligns to 16:446/448 of 6io1B
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
34% identity, 91% coverage: 42:454/456 of query aligns to 2:416/422 of 7qx3A
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
34% identity, 94% coverage: 27:454/456 of query aligns to 14:444/450 of 6gwiB
6s54A Transaminase from pseudomonas fluorescens (see paper)
35% identity, 90% coverage: 36:447/456 of query aligns to 27:450/453 of 6s54A
Sites not aligning to the query:
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
31% identity, 94% coverage: 28:455/456 of query aligns to 14:443/448 of 3du4A
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
31% identity, 94% coverage: 28:455/456 of query aligns to 14:443/448 of P53555
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
32% identity, 96% coverage: 17:454/456 of query aligns to 1:437/443 of 7qx0B
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
33% identity, 93% coverage: 30:452/456 of query aligns to 16:444/459 of D6R3B6
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
33% identity, 96% coverage: 18:456/456 of query aligns to 3:445/454 of 7ypmA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
32% identity, 93% coverage: 30:453/456 of query aligns to 14:443/453 of 6g4dB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
32% identity, 93% coverage: 30:453/456 of query aligns to 14:443/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
32% identity, 93% coverage: 30:453/456 of query aligns to 14:443/451 of 6g4eA
>Pf6N2E2_3463 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3463
MTCEVLSMNMPEHAAGSLASQLKLDAHWMPYTANRHFQRDPRLIVAAEGSWLVDDKGRKV
YDSLSGLWTCGAGHTRKEIQEAVAKQLGTLDYSPGFQYGHPLSFQLAEKITSLTPGNLNH
VFFTDSGSECADTAVKMVRAYWRLKGQATKTKMIGRARGYHGVNIAGTSLGGVNGNRKLF
GQAMMDVDHLPHTLLASNAYSRGMPKEGGIALADELLKLIELHDASNIAAVFVEPMAGSA
GVLVPPEGYLKRLREICDQHSILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTN
GAIPMGAVIASSEIYQTFMNQPTPEYAVEFPHGYTYSAHPVACAAGLAALDLLQKENLVQ
SVAEIAPHFENALHGLKGAKNVIDIRNYGLAGAIQIAGRDGDAIVRPFEAGMALWKAGFY
VRFGGDTLQFGPTFNSKPQDLDRLFDAVGEVLNKLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory