SitesBLAST
Comparing Pf6N2E2_3467 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3467 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
32% identity, 93% coverage: 8:486/517 of query aligns to 3:475/501 of P04983
- K43 (= K48) mutation to R: Loss of transport.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 42% coverage: 7:221/517 of query aligns to 1:213/369 of P19566
- L86 (= L95) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P169) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (≠ T174) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 43% coverage: 4:226/517 of query aligns to 11:232/378 of P69874
- C26 (≠ R18) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y19) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ I37) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ A46) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ M52) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ W68) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ Y130) mutation to M: Loss of ATPase activity and transport.
- D172 (= D167) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 42% coverage: 7:221/517 of query aligns to 1:213/371 of P68187
- A85 (≠ S94) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ T115) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ I123) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V126) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ R128) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (= A133) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G146) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D167) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
31% identity, 42% coverage: 8:226/517 of query aligns to 1:217/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y19), S37 (≠ N44), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), Q81 (= Q91), R128 (= R138), A132 (≠ S142), S134 (= S144), G136 (= G146), Q137 (≠ E147), E158 (= E168), H191 (= H200)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
31% identity, 42% coverage: 8:226/517 of query aligns to 1:217/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (= R138), S134 (= S144), Q137 (≠ E147)
- binding beryllium trifluoride ion: S37 (≠ N44), G38 (= G45), K41 (= K48), Q81 (= Q91), S134 (= S144), G136 (= G146), H191 (= H200)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
31% identity, 42% coverage: 8:226/517 of query aligns to 1:217/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), V17 (≠ A24), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (= R138), A132 (≠ S142), S134 (= S144), Q137 (≠ E147)
- binding tetrafluoroaluminate ion: S37 (≠ N44), G38 (= G45), K41 (= K48), Q81 (= Q91), S134 (= S144), G135 (≠ I145), G136 (= G146), E158 (= E168), H191 (= H200)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
31% identity, 42% coverage: 8:226/517 of query aligns to 1:217/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), V17 (≠ A24), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (= R138), A132 (≠ S142), S134 (= S144), Q137 (≠ E147)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
32% identity, 41% coverage: 8:221/517 of query aligns to 1:212/374 of 2awnB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 43% coverage: 10:232/517 of query aligns to 3:226/241 of 4u00A
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
31% identity, 41% coverage: 10:221/517 of query aligns to 1:210/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y19), S35 (≠ N44), G36 (= G45), C37 (≠ A46), G38 (= G47), K39 (= K48), S40 (= S49), T41 (= T50), R126 (= R138), A130 (≠ S142), S132 (= S144), G134 (= G146), Q135 (≠ E147)
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
32% identity, 41% coverage: 10:220/517 of query aligns to 4:217/230 of 6z4wA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
31% identity, 45% coverage: 8:241/517 of query aligns to 1:236/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
31% identity, 45% coverage: 8:241/517 of query aligns to 1:236/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (= Y19), R15 (≠ C22), N37 (= N44), G40 (= G47), K41 (= K48), T42 (≠ S49), T43 (= T50), Q84 (= Q91), S136 (= S142), S138 (= S144), E141 (= E147)
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
32% identity, 41% coverage: 10:220/517 of query aligns to 4:217/229 of 6z67B
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 43% coverage: 10:232/517 of query aligns to 4:228/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 43% coverage: 10:232/517 of query aligns to 4:228/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 43% coverage: 10:232/517 of query aligns to 4:228/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 43% coverage: 10:232/517 of query aligns to 4:228/242 of 2oljA
6mbnA Lptb e163q in complex with atp (see paper)
31% identity, 45% coverage: 8:241/517 of query aligns to 2:237/241 of 6mbnA
Query Sequence
>Pf6N2E2_3467 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3467
MSNPDSIARLQLRNISKRYPGCLANDAIDLSIQPGEIHALLGENGAGKSTLMKIIYGVTP
ADSGEVIWQGQRVNLRNPAQARSLGIGMVFQHFSLFETLTVAQNIALAMGAAAGTPAQLE
PRIREVSRRYGMALEPQRLVHSLSIGERQRVEIIRCLMQDIRLLILDEPTSVLTPVEAEE
LFVTLRRLASEGCSILFISHKLGEVRALCHSATVLRGGRVSGHCTPAHCTDRELAQLMVG
EAAGLITDYPKVSADKAFLQIDKLSWHNPDPFGCSLREIDLEVRSGEIVGIAGVAGNGQD
EWLALLSGETPLARQQGETIRFDGQPVAHLRPDARRRLGLAFVPAERLGHGAVPQLSLAD
NALLSAFQQGLVNHGLIRRSKVEHLAEEIIRRFGVKTRDTKTPARSLSGGNLQKFILGRE
ILQQPKLLVAAHPTWGVDVGAAATIHRALIALRDAGAAILVISEDLDELFQISDRLGALC
GGRLSALRPTVETRLSDVGGWMAGQFDAPQSPAPAPV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory