Comparing Pf6N2E2_3544 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3544 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 90% coverage: 18:254/262 of query aligns to 7:260/265 of P07821
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 79% coverage: 25:230/262 of query aligns to 17:224/240 of 4ymuJ
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 79% coverage: 25:231/262 of query aligns to 21:230/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 79% coverage: 25:231/262 of query aligns to 22:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 79% coverage: 25:231/262 of query aligns to 22:231/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 79% coverage: 25:231/262 of query aligns to 22:231/344 of 6cvlD
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 79% coverage: 25:231/262 of query aligns to 21:229/280 of 5x40A
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 79% coverage: 25:231/262 of query aligns to 18:225/241 of 4u00A
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 81% coverage: 27:239/262 of query aligns to 20:233/240 of 6mjpA
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
32% identity, 82% coverage: 16:231/262 of query aligns to 11:226/276 of Q5M243
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
32% identity, 97% coverage: 4:257/262 of query aligns to 3:250/280 of Q5M244
5d3mA Folate ecf transporter: amppnp bound state (see paper)
31% identity, 82% coverage: 25:238/262 of query aligns to 23:240/280 of 5d3mA
Sites not aligning to the query:
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
31% identity, 82% coverage: 25:238/262 of query aligns to 20:237/278 of 8bmpA
Sites not aligning to the query:
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
33% identity, 78% coverage: 18:221/262 of query aligns to 6:217/229 of A5U7B7
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
33% identity, 78% coverage: 18:221/262 of query aligns to 7:218/227 of 8igqA
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
33% identity, 78% coverage: 18:221/262 of query aligns to 7:218/225 of 8iddA
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
30% identity, 82% coverage: 25:238/262 of query aligns to 20:237/278 of 8bmsA
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
32% identity, 76% coverage: 23:220/262 of query aligns to 19:223/232 of 1f3oA
Sites not aligning to the query:
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
35% identity, 76% coverage: 27:226/262 of query aligns to 21:224/262 of 7chaI
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
30% identity, 75% coverage: 25:221/262 of query aligns to 20:218/229 of 6z67B
Sites not aligning to the query:
>Pf6N2E2_3544 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3544
MTSLTLSHLAWTPLGHGHCHHQFQLRDVTLQVAAGEFVGLIGPNGSGKTSLLRCAYRFSR
PAQGEVKLAHHNVWQQSSRWSAQRIAVVLQEFPDAFGLTVEEVVAMGRTPHKGLFDGDNH
DDRRLVLQALESAGLAGFGDHAFATLSGGEKQRVILARALAQQPQLLILDEPTNHLDPHY
QLQLLQLIKGLGIGTLASLHDLNLAAAFCDRLYVIEHGRIVASGTPREVLTVELLREVFG
IEALVDEHPLSGYPRITWITQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory