SitesBLAST
Comparing Pf6N2E2_372 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_372 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
40% identity, 89% coverage: 35:308/308 of query aligns to 42:315/315 of 5vg6B
- active site: M98 (≠ I91), R230 (= R223), D254 (= D247), E259 (= E252), H278 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A67), R92 (= R85), M102 (= M95), L147 (= L140), G148 (= G141), D149 (≠ L142), L150 (≠ Q143), W168 (= W161), S169 (≠ A162), R170 (= R163), T171 (≠ S164), K173 (≠ H166), L201 (= L194), P202 (= P195), T207 (= T200), V228 (≠ M221), R230 (= R223), H278 (= H271), A280 (= A273), S281 (≠ A274), Y315 (= Y308)
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
37% identity, 100% coverage: 1:308/308 of query aligns to 1:312/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (≠ S66), A65 (= A67), G66 (= G68), R227 (= R223), H275 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A67), R89 (= R85), M99 (= M95), A144 (≠ L140), G145 (= G141), V146 (≠ L142), L147 (≠ Q143), W165 (= W161), S166 (≠ A162), R167 (= R163), T168 (≠ S164), K170 (≠ H166), L198 (= L194), P199 (= P195), L225 (≠ M221), R227 (= R223), H275 (= H271), A278 (= A274), Y312 (= Y308)
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
37% identity, 100% coverage: 1:308/308 of query aligns to 1:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A67), R89 (= R85), M99 (= M95), A144 (≠ L140), G145 (= G141), V146 (≠ L142), L147 (≠ Q143), W165 (= W161), S166 (≠ A162), R167 (= R163), T168 (≠ S164), K170 (≠ H166), L198 (= L194), P199 (= P195), L225 (≠ M221), R227 (= R223), H275 (= H271), A277 (= A273), A278 (= A274), Y312 (= Y308)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: F10 (≠ V10), D11 (≠ R11), W15 (= W15), A65 (= A67), R227 (= R223), H275 (= H271), T280 (= T276)
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
37% identity, 100% coverage: 1:308/308 of query aligns to 2:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A67), R90 (= R85), M100 (= M95), A145 (≠ L140), G146 (= G141), V147 (≠ L142), L148 (≠ Q143), W166 (= W161), S167 (≠ A162), R168 (= R163), T169 (≠ S164), K171 (≠ H166), L199 (= L194), P200 (= P195), L226 (≠ M221), A227 (≠ G222), R228 (= R223), D252 (= D247), H276 (= H271), A279 (= A274), Y313 (= Y308)
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
35% identity, 100% coverage: 1:308/308 of query aligns to 1:312/312 of 3kboA
- active site: M95 (≠ I91), R227 (= R223), E256 (= E252), H275 (= H271)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: N36 (≠ P37), A53 (≠ L56), R55 (≠ N58), R56 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R85), M99 (= M95), G143 (= G139), A144 (≠ L140), G145 (= G141), V146 (≠ L142), L147 (≠ Q143), W165 (= W161), S166 (≠ A162), R167 (= R163), S168 (= S164), K170 (≠ H166), L197 (≠ V193), P199 (= P195), L225 (≠ M221), A226 (≠ G222), R227 (= R223), D251 (= D247), H275 (= H271), A278 (= A274), Y312 (= Y308)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
40% identity, 82% coverage: 56:308/308 of query aligns to 64:316/316 of 4zqbB
- active site: L99 (≠ I91), R231 (= R223), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (= R85), M103 (= M95), G147 (= G139), L148 (= L140), G149 (= G141), E150 (≠ L142), L151 (≠ Q143), W169 (= W161), S170 (≠ A162), R171 (= R163), S172 (= S164), K174 (≠ H166), L202 (= L194), P203 (= P195), F229 (≠ M221), R231 (= R223), H279 (= H271), S281 (≠ A273), A282 (= A274), Y316 (= Y308)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
34% identity, 89% coverage: 36:308/308 of query aligns to 41:317/317 of 5bqfA
- active site: E261 (= E252), H280 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A67), R90 (= R85), M100 (= M95), G144 (= G139), L145 (= L140), G146 (= G141), I147 (≠ L142), L148 (≠ Q143), W166 (= W161), S167 (≠ A162), R168 (= R163), T169 (≠ S164), L198 (= L194), P199 (= P195), A230 (≠ M221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (= A274), Y317 (= Y308)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
34% identity, 89% coverage: 36:308/308 of query aligns to 41:317/317 of 4xcvA
- active site: E261 (= E252), H280 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A67), R90 (= R85), M100 (= M95), G144 (= G139), L145 (= L140), G146 (= G141), I147 (≠ L142), L148 (≠ Q143), W166 (= W161), S167 (≠ A162), R168 (= R163), T169 (≠ S164), K171 (≠ H166), L198 (= L194), P199 (= P195), A230 (≠ M221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (= A274), Y317 (= Y308)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
34% identity, 89% coverage: 36:308/308 of query aligns to 40:316/316 of 5tsdA
- active site: E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A67), R89 (= R85), M99 (= M95), G143 (= G139), L144 (= L140), G145 (= G141), I146 (≠ L142), L147 (≠ Q143), W165 (= W161), S166 (≠ A162), R167 (= R163), T168 (≠ S164), K170 (≠ H166), L197 (= L194), P198 (= P195), A229 (≠ M221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), Y316 (= Y308)
- binding oxalic acid: W50 (= W46), G70 (≠ S66), A71 (= A67), G72 (= G68), R231 (= R223), H279 (= H271)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
36% identity, 90% coverage: 33:308/308 of query aligns to 30:316/316 of 4z0pA
- active site: L95 (≠ I91), R231 (= R223), G250 (≠ S242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R85), M99 (= M95), M144 (≠ L140), G145 (= G141), V146 (≠ L142), L147 (≠ Q143), W165 (= W161), S166 (≠ A162), R167 (= R163), S168 (= S164), R170 (≠ H166), L197 (= L194), P198 (= P195), A229 (≠ M221), G230 (= G222), R231 (= R223), H279 (= H271), A281 (= A273), A282 (= A274), Y316 (= Y308)
- binding oxalic acid: W50 (= W46), G70 (≠ S66), A71 (= A67), G72 (= G68), H114 (≠ M110), R115 (≠ L111), R231 (= R223), H279 (= H271)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
36% identity, 90% coverage: 33:308/308 of query aligns to 30:316/316 of 4weqA
- active site: L95 (≠ I91), R231 (= R223), G250 (≠ S242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (= R85), M99 (= M95), M144 (≠ L140), G145 (= G141), V146 (≠ L142), L147 (≠ Q143), W165 (= W161), S166 (≠ A162), R167 (= R163), S168 (= S164), R170 (≠ H166), L197 (= L194), P198 (= P195), A229 (≠ M221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), A281 (= A273), Y316 (= Y308)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
32% identity, 65% coverage: 103:302/308 of query aligns to 101:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: R224 (= R223), H272 (= H271), Y280 (vs. gap)
- binding magnesium ion: T130 (≠ V128), A132 (= A130), F210 (= F209), E211 (≠ Q210), M213 (≠ L212), G225 (= G224), P226 (≠ G225), V228 (≠ L227), E230 (= E229), D241 (≠ Q240), S251 (≠ E250)
- binding nicotinamide-adenine-dinucleotide: G142 (= G141), T143 (≠ L142), L144 (≠ Q143), R164 (= R163), P196 (= P195), T201 (= T200), V222 (≠ M221), A223 (≠ G222), R224 (= R223), H272 (= H271), S274 (≠ A273)
Sites not aligning to the query:
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
32% identity, 65% coverage: 103:302/308 of query aligns to 103:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R226 (= R223), H274 (= H271), Y282 (vs. gap)
- binding (2R)-2-hydroxyhexanoic acid: Y282 (vs. gap)
- binding magnesium ion: F212 (= F209), E213 (≠ Q210), M215 (≠ L212), D243 (≠ Q240)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L140), G144 (= G141), T145 (≠ L142), L146 (≠ Q143), R165 (≠ A162), R166 (= R163), S167 (= S164), P180 (≠ D177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ M221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
Sites not aligning to the query:
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
32% identity, 65% coverage: 103:302/308 of query aligns to 103:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: R226 (= R223), H274 (= H271), Y282 (vs. gap)
- binding magnesium ion: T132 (≠ V128), A134 (= A130)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L140), G144 (= G141), T145 (≠ L142), L146 (≠ Q143), R165 (≠ A162), R166 (= R163), S167 (= S164), P180 (≠ D177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ M221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
Sites not aligning to the query:
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
32% identity, 65% coverage: 103:302/308 of query aligns to 103:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: R226 (= R223), H274 (= H271), Y282 (vs. gap)
- binding magnesium ion: T132 (≠ V128), A134 (= A130), F212 (= F209), E213 (≠ Q210), M215 (≠ L212), D243 (≠ Q240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G142 (= G139), L143 (= L140), G144 (= G141), T145 (≠ L142), L146 (≠ Q143), R165 (≠ A162), R166 (= R163), S167 (= S164), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ M221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
Sites not aligning to the query:
7arzA Ternary complex of NAD-dependent formate dehydrogenase from physcomitrium patens
29% identity, 71% coverage: 58:276/308 of query aligns to 95:320/361 of 7arzA
- binding azide ion: L99 (= L62), V100 (≠ F63), T101 (≠ A64), G103 (≠ S66), V104 (≠ A67), R267 (= R223), H315 (= H271)
- binding nicotinamide-adenine-dinucleotide: V104 (≠ A67), N128 (≠ I91), V132 (≠ M95), G182 (= G141), R183 (≠ L142), I184 (≠ Q143), D204 (≠ A162), R205 (= R163), T238 (≠ L194), P239 (= P195), Q243 (= Q199), N265 (≠ M221), A266 (≠ G222), R267 (= R223), D291 (= D247), H315 (= H271), S317 (≠ A273), G318 (≠ A274)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
30% identity, 71% coverage: 58:276/308 of query aligns to 74:298/328 of Q9UBQ7
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
30% identity, 71% coverage: 58:276/308 of query aligns to 70:294/324 of 2gcgA
- active site: L103 (≠ I91), R241 (= R223), D265 (= D247), E270 (= E252), H289 (= H271)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (= S66), V79 (≠ A67), G80 (= G68), R241 (= R223), H289 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ A67), T107 (≠ M95), G156 (= G139), G158 (= G141), I160 (≠ Q143), G180 (= G160), R181 (vs. gap), R184 (= R163), C212 (≠ L194), S213 (≠ P195), T218 (= T200), I239 (≠ M221), R241 (= R223), D265 (= D247), H289 (= H271), G291 (≠ A273)
Sites not aligning to the query:
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
28% identity, 85% coverage: 44:305/308 of query aligns to 55:319/533 of O43175
- T78 (≠ A67) binding
- R135 (≠ A124) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ LQ 142:143) binding
- D175 (≠ E165) binding
- T207 (≠ L194) binding
- CAR 234:236 (≠ MGR 221:223) binding
- D260 (= D247) binding
- V261 (= V248) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIAA 271:274) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
3n7uA NAD-dependent formate dehydrogenase from higher-plant arabidopsis thaliana in complex with NAD and azide
31% identity, 56% coverage: 103:276/308 of query aligns to 131:310/351 of 3n7uA
- active site: R257 (= R223), D281 (= D247), Q286 (≠ E252), H305 (= H271)
- binding azide ion: R257 (= R223), H305 (= H271)
- binding nicotinamide-adenine-dinucleotide: G173 (= G141), R174 (≠ L142), I175 (≠ Q143), D194 (≠ A162), R195 (= R163), M228 (≠ L194), P229 (= P195), N255 (≠ M221), A256 (≠ G222), R257 (= R223), D281 (= D247), H305 (= H271), S307 (≠ A273), G308 (≠ A274)
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_372 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_372
MALLYKADPVRGEHWRRLFAEHAPDIEWRAWPDIGDPRDIQYLAAWQAPDDVETLLPNLQ
VLFALSAGVDQLDLSRLPTTLPVVRLLDPGISQGMCEYASFAVLSLHRDMLRYRQQQAER
CWQAHRLVPAGQRRVGVMGLGLQARQILATLKTFGFALSGWARSEHDIEGVVCFAGDKQL
PTFLGQCDIVLCVLPLTEQTRGILNRQLFQHLPKGAALVNMGRGGHLVEADLLEALADGQ
ISAAVLDVLEQEPAPMDHPFWHHPQILLTPHIAAMTQPESAFGVLLENIRRHQRGKSMLG
LVDRERNY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory