Comparing Pf6N2E2_3798 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3798 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q8U8Z6 Imidazolonepropionase; Imidazolone-5-propanoate hydrolase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
55% identity, 98% coverage: 4:394/400 of query aligns to 18:413/419 of Q8U8Z6
2puzB Crystal structure of imidazolonepropionase from agrobacterium tumefaciens with bound product n-formimino-l-glutamate (see paper)
56% identity, 96% coverage: 4:385/400 of query aligns to 4:389/404 of 2puzB
2gokA Crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution (see paper)
56% identity, 96% coverage: 4:385/400 of query aligns to 4:389/404 of 2gokA
2oofA The crystal structure of 4-imidazolone-5-propanoate amidohydrolase from environmental sample
56% identity, 98% coverage: 4:394/400 of query aligns to 6:397/403 of 2oofA
2q09A Crystal structure of imidazolonepropionase from environmental sample with bound inhibitor 3-(2,5-dioxo-imidazolidin-4-yl)-propionic acid (see paper)
56% identity, 98% coverage: 4:394/400 of query aligns to 5:396/402 of 2q09A
A0KF84 Imidazolonepropionase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) (see paper)
55% identity, 98% coverage: 4:394/400 of query aligns to 11:404/411 of A0KF84
2bb0A Structure of imidazolonepropionase from bacillus subtilis (see paper)
39% identity, 94% coverage: 20:396/400 of query aligns to 32:407/413 of 2bb0A
2g3fA Crystal structure of imidazolonepropionase complexed with imidazole-4- acetic acid sodium salt, a substrate homologue (see paper)
39% identity, 94% coverage: 20:396/400 of query aligns to 33:408/414 of 2g3fA
P42084 Imidazolonepropionase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Bacillus subtilis (strain 168) (see paper)
39% identity, 94% coverage: 20:396/400 of query aligns to 34:409/421 of P42084
6sj4A Amidohydrolase, ahs with substrate analog (see paper)
26% identity, 96% coverage: 19:400/400 of query aligns to 19:458/494 of 6sj4A
6sj3A Amidohydrolase, ahs with 3-hba (see paper)
26% identity, 96% coverage: 19:400/400 of query aligns to 19:458/494 of 6sj3A
6sj2B Amidohydrolase, ahs with 3-haa (see paper)
26% identity, 96% coverage: 19:400/400 of query aligns to 28:467/503 of 6sj2B
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
24% identity, 40% coverage: 215:374/400 of query aligns to 195:374/435 of 4gbdA
Sites not aligning to the query:
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
24% identity, 40% coverage: 215:374/400 of query aligns to 195:374/437 of 4dykA
Sites not aligning to the query:
>Pf6N2E2_3798 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3798
MKTLWQNCHAATMAQGVYSIIEDAAIVTQGKHIQWIGPRAELPTGDYPAVNDLKGAWVTP
GLIDCHTHTVFGGNRSGEFEQRLQGVSYAEIAAAGGGIASTVRATRAASEDELFASAAKR
LGSLMRDGVTTVEIKSGYGLDLASERKILRVIRRLGAELPVSVRSTCLAAHALPPEYKDR
ADDYIEHICSEMLPALAAEGLVDAVDAFCEYLAFSPAQVERVFITAQQLGLPVKLHAEQL
SSLHGSSLAARYQALSADHLEFMTEDDAKAMAASGTVAVLLPGAFYFLRETQLPPMEALR
KHGVKIAVASDLNPGTSPALSLRLMLNMACTCFRMTPEEALAGVTIHAAQALGMAQTHGS
LEAGKVADFVAWHIDRPADLAYWLGGDLEKRVVRHGVEID
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory