SitesBLAST
Comparing Pf6N2E2_383 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_383 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
41% identity, 97% coverage: 1:248/255 of query aligns to 1:246/247 of 4jroC
- active site: G16 (= G17), S142 (= S142), Q152 (≠ R153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ A15), R15 (≠ M16), G16 (= G17), I17 (= I18), N35 (≠ C36), Y36 (≠ D37), N37 (≠ I38), G38 (≠ N39), S39 (≠ T40), N63 (≠ D63), V64 (= V64), N90 (≠ S90), A91 (= A91), I93 (= I93), I113 (= I113), S142 (= S142), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ V189), T190 (= T191)
5ovkA Crystal structure maba bound to NADPH from m. Smegmatis (see paper)
40% identity, 93% coverage: 10:247/255 of query aligns to 14:238/242 of 5ovkA
P71534 3-oxoacyl-[acyl-carrier-protein] reductase MabA; 3-ketoacyl-acyl carrier protein reductase; Acetoacetyl-CoA reductase; Beta-ketoacyl-ACP reductase; Beta-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100; EC 1.1.1.36 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
40% identity, 93% coverage: 10:247/255 of query aligns to 27:251/255 of P71534
5ovlA Crystal structure of maba bound to NADP+ from m. Smegmatis (see paper)
40% identity, 93% coverage: 10:247/255 of query aligns to 13:237/241 of 5ovlA
- active site: G20 (= G17), S134 (= S142), Y147 (= Y156), L154 (≠ V163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), N18 (≠ A15), R19 (≠ M16), G20 (= G17), I21 (= I18), R41 (= R51), D55 (= D63), V56 (= V64), N82 (≠ S90), A83 (= A91), I85 (= I93), T105 (≠ I113), I132 (= I140), S134 (= S142), Y147 (= Y156), K151 (= K160), P177 (= P186), G178 (= G187), I180 (≠ V189)
6qheA Alcohol dehydrogenase from arthrobacter sp. Ts-15 in complex with NAD+
35% identity, 95% coverage: 6:247/255 of query aligns to 7:254/261 of 6qheA
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), M17 (= M16), G18 (= G17), M19 (≠ I18), D38 (= D37), R39 (≠ I38), D63 (= D63), I64 (≠ V64), A90 (≠ S90), A91 (= A91), S142 (= S142), Y156 (= Y156), K160 (= K160), P186 (= P186), G187 (= G187), M189 (≠ V189), T191 (= T191), P192 (= P192), M193 (= M193)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
40% identity, 95% coverage: 7:247/255 of query aligns to 17:257/261 of 5u9pB
- active site: G27 (= G17), S152 (= S142), Y165 (= Y156), K169 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G13), R26 (≠ M16), G27 (= G17), I28 (= I18), R48 (≠ I38), D73 (= D63), V74 (= V64), N100 (≠ S90), A101 (= A91), I150 (= I140), Y165 (= Y156), K169 (= K160), P195 (= P186), F198 (≠ V189), T200 (= T191), L202 (≠ M193), N203 (≠ T194)
1uznA Maba from mycobacterium tuberculosis (see paper)
38% identity, 93% coverage: 10:247/255 of query aligns to 11:235/239 of 1uznA
- active site: G18 (= G17), S132 (= S142), Y145 (= Y156), K149 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), N16 (≠ A15), R17 (≠ M16), I19 (= I18), R39 (= R51), D53 (= D63), V54 (= V64), A81 (= A91), G82 (= G92)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
38% identity, 94% coverage: 7:246/255 of query aligns to 14:262/267 of Q9LBG2
- 17:42 (vs. 10:35, 38% identical) binding
- E103 (vs. gap) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
38% identity, 94% coverage: 7:246/255 of query aligns to 5:253/258 of 1iy8A
- active site: G15 (= G17), S143 (= S142), Q153 (≠ R153), Y156 (= Y156), K160 (= K160)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), S14 (≠ M16), G15 (= G17), L16 (≠ I18), D35 (= D37), V36 (≠ I38), A62 (vs. gap), D63 (= D63), V64 (= V64), N90 (≠ S90), G92 (= G92), I93 (= I93), T141 (≠ I140), S143 (= S142), Y156 (= Y156), K160 (= K160), P186 (= P186), G187 (= G187), T191 (= T191), P192 (= P192), M193 (= M193)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
37% identity, 95% coverage: 7:249/255 of query aligns to 7:251/252 of 1vl8B
- active site: G17 (= G17), S143 (= S142), I154 (≠ R153), Y157 (= Y156), K161 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), R16 (≠ M16), G17 (= G17), L18 (≠ I18), S37 (≠ D37), R38 (≠ I38), C63 (≠ I62), D64 (= D63), V65 (= V64), A91 (≠ S90), A92 (= A91), G93 (= G92), I94 (= I93), V114 (≠ I113), I141 (= I140), S143 (= S142), Y157 (= Y156), K161 (= K160), P187 (= P186), G188 (= G187), Y190 (≠ V189), T192 (= T191), M194 (= M193), T195 (= T194)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
36% identity, 97% coverage: 3:250/255 of query aligns to 3:260/260 of 6zzqA
- active site: G17 (= G17), S142 (= S142), Y155 (= Y156)
- binding acetoacetic acid: Q94 (≠ A94), S142 (= S142), K152 (≠ R153), Y155 (= Y156), Q196 (≠ L197)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), S16 (≠ M16), G17 (= G17), I18 (= I18), D37 (= D37), M38 (≠ I38), D63 (= D63), V64 (= V64), N90 (≠ S90), A91 (= A91), G92 (= G92), M140 (≠ I140), A141 (= A141), S142 (= S142), Y155 (= Y156), K159 (= K160), Y187 (≠ P188), V188 (= V189), T190 (= T191)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
36% identity, 97% coverage: 3:250/255 of query aligns to 4:261/261 of 6zzsD
- active site: G18 (= G17), S143 (= S142), Y156 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), S17 (≠ M16), I19 (= I18), D38 (= D37), M39 (≠ I38), D64 (= D63), V65 (= V64), N91 (≠ S90), A92 (= A91), G93 (= G92), M141 (≠ I140), A142 (= A141), S143 (= S142), Y156 (= Y156), K160 (= K160), P186 (= P186), G187 (= G187), V189 (= V189), T191 (= T191), L193 (≠ M193)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A94), S143 (= S142), N145 (≠ A144), K153 (≠ R153), Y156 (= Y156), Q197 (≠ L197)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
37% identity, 95% coverage: 7:247/255 of query aligns to 6:241/244 of 6t77A
- active site: G16 (= G17), S138 (= S142), Y151 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ A15), R15 (≠ M16), T37 (≠ E42), L58 (≠ I62), N59 (≠ D63), V60 (= V64), A87 (= A91), G88 (= G92), I89 (= I93)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
38% identity, 96% coverage: 3:247/255 of query aligns to 3:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), Q15 (≠ M16), G16 (= G17), I17 (= I18), D36 (= D37), V63 (= V64), N89 (≠ S90), A91 (≠ G92), S94 (≠ K95), I142 (= I140), S143 (≠ A141), S144 (= S142), Y157 (vs. gap), K161 (= K160), P187 (= P186), H188 (≠ G187), I190 (≠ V189), I194 (≠ M193)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
41% identity, 96% coverage: 5:249/255 of query aligns to 4:247/247 of 6j7uA
- active site: G16 (= G17), S142 (= S142), Y156 (= Y156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ A15), R15 (≠ M16), I17 (= I18), Y36 (≠ D37), V37 (≠ I38), S38 (≠ N39), S41 (≠ E42), D65 (= D63), S66 (≠ V64), N92 (≠ S90), A93 (= A91), G94 (= G92), I115 (= I113), G141 (≠ A141), S142 (= S142), Y156 (= Y156), K160 (= K160), P186 (= P186), T191 (= T191), M193 (= M193), N194 (≠ T194)
P9WGT3 3-oxoacyl-[acyl-carrier-protein] reductase MabA; 3-ketoacyl reductase; 3-ketoacyl-acyl carrier protein reductase; Acetoacetyl-CoA reductase; Beta-ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; Mycolic acid biosynthesis A; EC 1.1.1.100; EC 1.1.1.36 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 7 papers)
38% identity, 93% coverage: 10:247/255 of query aligns to 19:243/247 of P9WGT3
- T21 (= T12) modified: Phosphothreonine; mutation to A: Slight decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-114 and A-191.
- RGI 25:27 (≠ MGI 16:18) binding
- R47 (= R51) binding
- C60 (vs. gap) mutation to V: Displays a lower activity than the wild-type and a slightly decreased affinity for the cofactor. Retains 84% of activity; when associated with L-144. Totally inactive; when associated with A-139 and L-144.
- DV 61:62 (= DV 63:64) binding
- G90 (= G92) binding
- T114 (= T116) modified: Phosphothreonine; mutation to A: Slight decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-21 and A-191.
- G139 (≠ A141) mutation to A: Complete protein inactivation and freezes the catalytic site into its closed form. Totally inactive; when associated with V-60 and L-144.
- S140 (= S142) mutation to A: Loss of activity. Can still bind NADPH.; mutation to T: Loss of activity. Impaired NADPH binding.
- S144 (≠ M146) mutation to L: Stabilizes the catalytic loop in its open active form. Retains 84% of activity; when associated with V-60. Totally inactive; when associated with V-60 and A-139.
- Y185 (≠ P188) mutation to L: 70% decrease in activity with acetoacetyl-CoA as substrate. Does not affect NADP binding.
- T191 (= T194) modified: Phosphothreonine; mutation to A: Retains 22% of wild-type reductase activity. Strong decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-21 and A-114.; mutation to D: Phosphomimetic mutant that retains less than 10% of wild-type reductase activity. Impaired NADPH binding. Overproduction of the mutant leads to a significant inhibition of de novo biosynthesis of mycolic acids.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 95% coverage: 7:247/255 of query aligns to 6:241/244 of P0AEK2
- GASR 12:15 (≠ GGAM 13:16) binding
- T37 (≠ E42) binding
- NV 59:60 (≠ DV 63:64) binding
- N86 (≠ S90) binding
- Y151 (= Y156) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YGTSK 156:160) binding
- A154 (≠ S159) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K160) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V189) binding
- E233 (≠ I239) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 95% coverage: 7:247/255 of query aligns to 5:240/243 of 1q7bA
- active site: G15 (= G17), E101 (≠ V106), S137 (= S142), Q147 (≠ R153), Y150 (= Y156), K154 (= K160)
- binding calcium ion: E232 (≠ I239), T233 (≠ V240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ A15), R14 (≠ M16), T36 (≠ E42), N58 (≠ D63), V59 (= V64), N85 (≠ S90), A86 (= A91), G87 (= G92), I88 (= I93), S137 (= S142), Y150 (= Y156), K154 (= K160), P180 (= P186), G181 (= G187), I183 (≠ V189)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
36% identity, 95% coverage: 7:247/255 of query aligns to 5:240/243 of 1q7cA
- active site: G15 (= G17), S137 (= S142), Q147 (≠ R153), F150 (≠ Y156), K154 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ A15), R14 (≠ M16), A35 (≠ T41), T36 (≠ E42), L57 (≠ I62), N58 (≠ D63), V59 (= V64), G87 (= G92), I88 (= I93)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
38% identity, 97% coverage: 1:248/255 of query aligns to 4:246/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G13), R18 (≠ M16), G19 (= G17), I20 (= I18), D39 (= D37), R40 (≠ N39), C63 (≠ I62), I65 (≠ V64), N91 (≠ S90), G93 (= G92), I94 (= I93), V114 (≠ I113), Y155 (= Y156), K159 (= K160), I188 (≠ V189), T190 (= T191), T193 (= T194)
Query Sequence
>Pf6N2E2_383 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_383
MTLANKKVAVITGGAMGIGAEAASALASDGHHVIICDINTTEAERFAQQLRDQGFCADAF
QIDVGTPASVSAAFEWVEAKFGRCDVLVNSAGIAKTMPFLEFDADVFNRTMLINVTGTFL
CCQLAARIMRKHEFGRIINIASVAGMRAVGKGRTAYGTSKGAVIALTRQMAVELSEYGIT
ANAIAPGPVDTPMTKELHSDEFRKAYSNAIPAKRYGTTREIAGAVSYLASDVSAYVNGIV
LPVDGGFLAWGAGDI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory