SitesBLAST
Comparing Pf6N2E2_3877 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3877 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
39% identity, 42% coverage: 557:955/959 of query aligns to 2:394/404 of 6torB
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
33% identity, 43% coverage: 536:951/959 of query aligns to 2:414/423 of 5g4jA
- active site: S14 (≠ Q548), Y130 (= Y664), D201 (≠ E738), D234 (= D771), Q237 (= Q774), K264 (= K801), T294 (≠ S831), K395 (= K932)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (≠ L578), R73 (= R607), G103 (= G637), S104 (≠ T638), Y130 (= Y664), H131 (= H665), D234 (= D771), V236 (= V773), Q237 (= Q774), K264 (= K801), T294 (≠ S831), R397 (≠ K934)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
33% identity, 43% coverage: 536:951/959 of query aligns to 2:414/423 of 5g4iA
- active site: S14 (≠ Q548), Y130 (= Y664), D201 (≠ E738), D234 (= D771), Q237 (= Q774), K264 (= K801), T294 (≠ S831), K395 (= K932)
- binding pyridoxal-5'-phosphate: G103 (= G637), S104 (≠ T638), H131 (= H665), D234 (= D771), V236 (= V773), Q237 (= Q774), K264 (= K801)
- binding phosphate ion: Y44 (≠ L578), R397 (≠ K934)
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
31% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1zobA
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding calcium ion: L76 (≠ T604), S78 (= S606), V303 (≠ G833), S304 (≠ G834), D305 (≠ S835)
- binding pyridoxal-5'-phosphate: T108 (≠ S636), A110 (≠ T638), N113 (= N641), W136 (≠ Y664), H137 (= H665), E208 (= E738), D241 (= D771), A243 (≠ V773), Q244 (= Q774), K270 (= K801)
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
31% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1zc9A
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G637), A110 (≠ T638), W136 (≠ Y664), H137 (= H665), E208 (= E738), D241 (= D771), A243 (≠ V773), Q244 (= Q774), K270 (= K801)
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
31% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1m0qA
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (vs. gap), T108 (≠ S636), A110 (≠ T638), W136 (≠ Y664), H137 (= H665), E208 (= E738), S213 (≠ N743), D241 (= D771), A243 (≠ V773), Q244 (= Q774), K270 (= K801), R404 (≠ K932)
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
31% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1m0pA
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (vs. gap), T108 (≠ S636), A110 (≠ T638), W136 (≠ Y664), H137 (= H665), E208 (= E738), S213 (≠ N743), D241 (= D771), A243 (≠ V773), Q244 (= Q774), K270 (= K801), R404 (≠ K932)
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
31% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1m0oA
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (vs. gap), G109 (= G637), A110 (≠ T638), W136 (≠ Y664), H137 (= H665), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), R404 (≠ K932)
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
31% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1m0nA
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (vs. gap), M51 (vs. gap), A110 (≠ T638), N113 (= N641), W136 (≠ Y664), H137 (= H665), E208 (= E738), S213 (≠ N743), D241 (= D771), A243 (≠ V773), Q244 (= Q774), K270 (= K801), R404 (≠ K932)
1dgdA An alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase (see paper)
31% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1dgdA
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding pyridoxal-5'-phosphate: T108 (≠ S636), G109 (= G637), A110 (≠ T638), W136 (≠ Y664), H137 (= H665), E208 (= E738), D241 (= D771), A243 (≠ V773), Q244 (= Q774), K270 (= K801)
1d7vA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma (see paper)
30% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1d7vA
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding potassium ion: H75 (vs. gap), L76 (≠ T604), F77 (≠ N605), S78 (= S606), T301 (≠ S831), H302 (≠ A832), V303 (≠ G833), S304 (≠ G834), D305 (≠ S835)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-2-methylalanine: A110 (≠ T638), W136 (≠ Y664), H137 (= H665), E208 (= E738), S213 (≠ N743), D241 (= D771), A243 (≠ V773), Q244 (= Q774), K270 (= K801), R404 (≠ K932)
1d7uA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with lcs (see paper)
30% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1d7uA
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding potassium ion: H75 (vs. gap), L76 (≠ T604), F77 (≠ N605), S78 (= S606), T301 (≠ S831), H302 (≠ A832), V303 (≠ G833), S304 (≠ G834), D305 (≠ S835)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G109 (= G637), A110 (≠ T638), W136 (≠ Y664), H137 (= H665), E208 (= E738), D241 (= D771), A243 (≠ V773), Q244 (= Q774), K270 (= K801), R404 (≠ K932)
1d7sA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with dcs (see paper)
30% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1d7sA
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Q50 (vs. gap), G109 (= G637), A110 (≠ T638), W136 (≠ Y664), H137 (= H665), E208 (= E738), D241 (= D771), A243 (≠ V773), Q244 (= Q774), K270 (= K801), R404 (≠ K932)
- binding potassium ion: H75 (vs. gap), L76 (≠ T604), F77 (≠ N605), S78 (= S606), T301 (≠ S831), H302 (≠ A832), V303 (≠ G833), S304 (≠ G834), D305 (≠ S835)
1d7rA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa (see paper)
30% identity, 44% coverage: 541:959/959 of query aligns to 4:431/431 of 1d7rA
- active site: G19 (vs. gap), W136 (≠ Y664), E208 (= E738), D241 (= D771), Q244 (= Q774), K270 (= K801), T301 (≠ S831), R404 (≠ K932)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: G109 (= G637), A110 (≠ T638), W136 (≠ Y664), H137 (= H665), E208 (= E738), S213 (≠ N743), D241 (= D771), A243 (≠ V773), Q244 (= Q774), K270 (= K801), R404 (≠ K932)
- binding potassium ion: H75 (vs. gap), L76 (≠ T604), F77 (≠ N605), S78 (= S606), T301 (≠ S831), H302 (≠ A832), V303 (≠ G833), S304 (≠ G834), D305 (≠ S835)
5wyaA Structure of amino acid racemase, 2.65 a (see paper)
30% identity, 44% coverage: 536:959/959 of query aligns to 8:429/439 of 5wyaA
- active site: A20 (≠ Q548), Y140 (= Y664), E215 (= E738), D248 (= D771), N251 (≠ Q774), K278 (= K801), T307 (≠ S830), R406 (≠ K932)
- binding (2S,3S)-3-methyl-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]pentanoic acid: A52 (≠ V581), Y82 (≠ R607), S112 (= S636), G113 (= G637), S114 (≠ T638), Y140 (= Y664), H141 (= H665), E215 (= E738), D248 (= D771), V250 (= V773), N251 (≠ Q774), K278 (= K801), F306 (= F829), T307 (≠ S830), R406 (≠ K932)
4ysnC Structure of aminoacid racemase in complex with plp (see paper)
30% identity, 44% coverage: 536:959/959 of query aligns to 17:438/448 of 4ysnC
- active site: A29 (≠ Q548), Y149 (= Y664), E224 (= E738), D257 (= D771), N260 (≠ Q774), K287 (= K801), T316 (≠ S830), R415 (≠ K932)
- binding pyridoxal-5'-phosphate: S121 (= S636), G122 (= G637), S123 (≠ T638), Y149 (= Y664), H150 (= H665), E224 (= E738), D257 (= D771), V259 (= V773), K287 (= K801), F315 (= F829), T316 (≠ S830)
5wyfA Structure of amino acid racemase, 2.12 a (see paper)
30% identity, 44% coverage: 536:959/959 of query aligns to 10:431/446 of 5wyfA
- active site: A22 (≠ Q548), Y142 (= Y664), E217 (= E738), D250 (= D771), N253 (≠ Q774), K280 (= K801), T309 (≠ S830), R408 (≠ K932)
- binding n-[o-phosphono-pyridoxyl]-isoleucine: A54 (≠ V581), Y84 (≠ R607), G115 (= G637), S116 (≠ T638), Y142 (= Y664), H143 (= H665), D222 (≠ N743), D250 (= D771), V252 (= V773), N253 (≠ Q774), K280 (= K801), F308 (= F829), T309 (≠ S830), R408 (≠ K932)
5ghgB Transaminase w58l with smba
31% identity, 43% coverage: 546:957/959 of query aligns to 10:426/433 of 5ghgB
- active site: Y16 (= Y552), Y143 (= Y664), E217 (= E738), D250 (= D771), I253 (≠ Q774), K279 (= K801), A401 (≠ N929)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S109 (= S636), G110 (= G637), S111 (≠ T638), Y143 (= Y664), H144 (= H665), E217 (= E738), D250 (= D771), V252 (= V773), I253 (≠ Q774), K279 (= K801)
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
30% identity, 45% coverage: 529:957/959 of query aligns to 4:444/451 of 6g4fA
- active site: Y15 (≠ F544), Y146 (= Y664), D253 (= D771), K282 (= K801)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S112 (= S636), G113 (= G637), S114 (≠ T638), Y146 (= Y664), H147 (= H665), E220 (= E738), D253 (= D771), V255 (= V773), I256 (≠ Q774), K282 (= K801)
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
30% identity, 45% coverage: 529:957/959 of query aligns to 4:444/451 of 6g4eA
- active site: Y15 (≠ F544), Y146 (= Y664), D253 (= D771), K282 (= K801)
- binding 6-aminohexanoic acid: K282 (= K801), R412 (≠ Q922), M414 (≠ T924)
- binding pyridoxal-5'-phosphate: S112 (= S636), G113 (= G637), S114 (≠ T638), Y146 (= Y664), H147 (= H665), E220 (= E738), D253 (= D771), V255 (= V773), I256 (≠ Q774), K282 (= K801)
Query Sequence
>Pf6N2E2_3877 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3877
LPSPQISAEQALVLLRSNYGLSGDLRPLGSNQDLNYRVDSERGRFVLKICHGDYAVQELQ
AQHAALKQLAGHGAVKVPRVITASNGQDLLTLDVDGQAIHMRLLEYIDGQSLTQLKHLPL
ELVTGLGRLCAEMDLALATFDHPGLERTLQWDARHAPALVDHLLPVIDDDQRRQLIAEVA
QQAERRLQSLKASLPVQAIHMDITDDNVVWQRDAQRQWQLQGVIDFGDLIRTWRITDLSV
TCAALLHHADGDPFFILPAIKAYQAVNPLQREELLALWPLIVARAAVLVLSGEQQVSIDP
DNQYSRDNLAHEWEIFRVAHSVPFELMEAAIFTAVGHSLPPIASEGFAPLLPTLVGREFA
LIDLGVLSPHFEAGNWEQPGIDQRLLSEAAGVHGLAASRYGQYRLSRTRPDSAVEPDTYP
LHVELSVPRGTPLESPFAGVVHKAADGLLQLDSAQLSVRLWGVTSPLHSGAALVKGQVLG
EVTGPLRVQLCRGAQVNPPLFCTPSRAAAWQALCPSPAVLLGLACDAEPEIDPQVLLARR
DASFARSQKHYYVDPPRIERGWRNHLIDMQGRSYLDMLNNVAVLGHGHPRMAAVAARQWS
LLNTNSRFHYAAIAEFSERLLALAPSNMDRVFLVNSGTEANDLAIRLAWAYSGGRDMLSV
LEAYHGWSVAADAVSTSIADNPQALSSRPDWVHPVTAPNIYRGEFRGPDTAPDYVRSVEH
NLAKIAENNRQLAGFICEPVYGNAGGIALPPGYLKQVYAMVRERGGVCIADEVQVGYGRM
GEFFWGFEEQGVVPDIITMAKGMGNGQPLGAVITRREIAEALEAEGYFFSSAGGSPVSCQ
IGMAVLDVMEEEHLWENARVVGGHFKARLEALIDRYPLVGAVHGSGFYLGVELIRDRDTL
EPATEETTALCNRLRALGIFMQPTGDYLNILKIKPPMVTTRQSVDFFVDMLVKVLDEGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory