Comparing Pf6N2E2_394 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_394 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4h15A Crystal structure of a short chain alcohol dehydrogenase-related dehydrogenase (target id nysgrc-011812) from sinorhizobium meliloti 1021 in space group p21
71% identity, 99% coverage: 4:258/258 of query aligns to 7:261/261 of 4h15A
4h16A Crystal structure of a short chain alcohol dehydrogenase-related dehydrogenase (target id nysgrc-011812) from sinorhizobium meliloti 1021 in space group p6422
71% identity, 99% coverage: 4:258/258 of query aligns to 4:258/258 of 4h16A
3ai2A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH (see paper)
36% identity, 99% coverage: 2:257/258 of query aligns to 1:262/263 of 3ai2A
3ai3C The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
36% identity, 99% coverage: 2:257/258 of query aligns to 1:262/263 of 3ai3C
Sites not aligning to the query:
3ai3A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
36% identity, 99% coverage: 2:257/258 of query aligns to 1:262/263 of 3ai3A
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
34% identity, 97% coverage: 4:253/258 of query aligns to 4:243/247 of 3op4A
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
32% identity, 96% coverage: 6:253/258 of query aligns to 2:239/243 of 7emgB
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
32% identity, 97% coverage: 4:253/258 of query aligns to 1:240/244 of 6t77A
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
33% identity, 97% coverage: 4:253/258 of query aligns to 4:239/243 of 4i08A
3tzcA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae (see paper)
33% identity, 97% coverage: 4:253/258 of query aligns to 4:222/224 of 3tzcA
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 97% coverage: 4:253/258 of query aligns to 1:240/244 of P0AEK2
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
31% identity, 96% coverage: 6:253/258 of query aligns to 2:239/243 of 1q7bA
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 97% coverage: 4:253/258 of query aligns to 1:240/244 of P0A2C9
1o5iB Crystal structure of 3-oxoacyl-(acyl carrier protein) reductase (tm1169) from thermotoga maritima at 2.50 a resolution
33% identity, 97% coverage: 5:253/258 of query aligns to 1:228/234 of 1o5iB
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
31% identity, 96% coverage: 6:253/258 of query aligns to 2:239/243 of 1q7cA
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
32% identity, 97% coverage: 3:253/258 of query aligns to 2:237/241 of 4bnzA
4bnxA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution (see paper)
32% identity, 97% coverage: 3:253/258 of query aligns to 2:236/239 of 4bnxA
4bnyA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 4-(2-phenylthieno(3,2-d) pyrimidin-4-yl)morpholine at 1.8a resolution (see paper)
32% identity, 97% coverage: 3:253/258 of query aligns to 1:235/239 of 4bnyA
1xkqA Crystal structure of short-chain dehydrogenase/reductase of unknown function from caenorhabditis elegans with cofactor
30% identity, 97% coverage: 6:254/258 of query aligns to 3:261/272 of 1xkqA
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
29% identity, 95% coverage: 9:253/258 of query aligns to 6:240/244 of 6wprA
>Pf6N2E2_394 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_394
MLNLGLSGKRVLVTGGTKGIGKAVVELFLAEGAQVLTSARKASGTLSDNLLVQADLSTRE
GCDAVVAATRQRLGSVDIIVHVLGGSSAPGGGFAALDEEQWQRELNLNLFPAVRLDRALL
PDMLERKEGVILHVTSIQSRLPLPEATTAYAAAKAALSTYSKSLSKEVSPKGVRVVRVSP
GWVETEASVALAERLAQEAGTDYQGGKQIIMQALGGIPLGRPSSPSEVADLIGFLASPRA
SSITGSEFVIDGGTVPTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory