Comparing Pf6N2E2_3942 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3942 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
39% identity, 72% coverage: 180:724/759 of query aligns to 3:549/572 of 2hwgA
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 72% coverage: 180:724/759 of query aligns to 4:550/575 of P08839
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
36% identity, 71% coverage: 180:721/759 of query aligns to 7:549/573 of P23533
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
36% identity, 71% coverage: 180:719/759 of query aligns to 6:545/570 of 2wqdA
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
44% identity, 42% coverage: 426:745/759 of query aligns to 4:324/324 of 2xz7A
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
44% identity, 42% coverage: 430:745/759 of query aligns to 1:317/317 of 2xz9A
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
25% identity, 51% coverage: 329:713/759 of query aligns to 424:850/850 of 5lu4A
Sites not aligning to the query:
Q02KR1 Phosphoenolpyruvate synthase; PEP synthase; Pyruvate, water dikinase; EC 2.7.9.2 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
27% identity, 48% coverage: 349:712/759 of query aligns to 404:786/791 of Q02KR1
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 51% coverage: 329:713/759 of query aligns to 513:960/963 of O23404
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
24% identity, 51% coverage: 329:713/759 of query aligns to 351:795/797 of 5jvjB
Sites not aligning to the query:
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
25% identity, 50% coverage: 328:704/759 of query aligns to 421:859/872 of 1kc7A
Sites not aligning to the query:
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
25% identity, 50% coverage: 328:704/759 of query aligns to 422:860/874 of P22983
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
24% identity, 51% coverage: 329:713/759 of query aligns to 424:872/874 of 5jvlA
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
24% identity, 51% coverage: 329:713/759 of query aligns to 503:951/953 of Q39735
Sites not aligning to the query:
1vbgA Pyruvate phosphate dikinase from maize (see paper)
25% identity, 50% coverage: 331:713/759 of query aligns to 426:872/874 of 1vbgA
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
24% identity, 50% coverage: 331:713/759 of query aligns to 499:945/947 of P11155
Sites not aligning to the query:
1vbhA Pyruvate phosphate dikinase with bound mg-pep from maize (see paper)
25% identity, 50% coverage: 331:713/759 of query aligns to 417:860/862 of 1vbhA
Sites not aligning to the query:
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
24% identity, 47% coverage: 361:713/759 of query aligns to 123:518/520 of 5jvlB
Sites not aligning to the query:
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
28% identity, 23% coverage: 201:373/759 of query aligns to 267:440/472 of P37349
Sites not aligning to the query:
>Pf6N2E2_3942 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3942
MLNTLRKIVQEVNSAKDLKAALGIIVLRVKEAMGSQVCSVYLLDPETNRFVLMATEGLNK
RSIGKVSMAPNEGLVGLVGTREEPLNLENAADHPRYRYFAETGEERYASFLGAPIIHHRR
VVGVLVIQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEATGSISGLGRQGKGIQEAKFVG
VPGSPGAAVGTAVVMLPPADLDVVPDKAITDIDAELGLFKTAIEGVRADMRALSAKLATQ
LRPEERALFDVYLMMLDDASLGSEVTTVIKTGQWAQGALRQVVTDHVNRFELMDDAYLRE
RASDVKDLGRRLLAYLQQERQQTLVYPDNTILVSEELTPAMLGEVPEGKLAGLVSVLGSG
NSHVAILARAMGIPTVMGLVDLPYSKVDGIQMIVDGYHGEVYTNPSDVLRKQFADVVEEE
KQLSLGLDALRDLPCVTLDGHRMPLWVNTGLLADVARAQKRGAEGVGLYRTEVPFMINQR
FPSEKEQLAIYREQLAAFHPQPVTMRSLDIGGDKSLSYFPIKEDNPFLGWRGIRVTLDHP
EIFLVQARAMLKASEGLNNLRILLPMISGTHELEEALHLIHRAWGEVRDEGTDVPMPPIG
VMIEIPAAVYQTKELARQVDFLSVGSNDLTQYLLAVDRNNPRVADLYDYLHPAVLQALQN
VVRDAHAEGKPVSICGEMAGDPAAAVLLMAMGFDSLSMNATNLPKVKWMLRQINLSKAQE
LLAEVMTIDNPQVIHSSLQLALKNLGLARMINPASNKTL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory