SitesBLAST
Comparing Pf6N2E2_4027 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4027 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6tukB Crystal structure of fdr9 (see paper)
33% identity, 72% coverage: 118:485/510 of query aligns to 4:365/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (≠ I121), G8 (= G122), G9 (≠ A123), G10 (= G124), A12 (= A126), A34 (≠ R148), E35 (= E149), R42 (= R156), P43 (≠ T157), K47 (= K161), A75 (≠ E193), A76 (≠ V194), T102 (= T221), G103 (= G222), V118 (≠ L241), R119 (= R242), G259 (= G387), D260 (= D388), H277 (= H403), W278 (= W404), F311 (= F431), W312 (= W432)
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
32% identity, 67% coverage: 134:475/510 of query aligns to 22:369/409 of 3lxdA
- active site: R44 (= R156), P45 (≠ T157), N302 (≠ Q408)
- binding flavin-adenine dinucleotide: R36 (= R148), E37 (= E149), R44 (= R156), P45 (≠ T157), S48 (= S160), K49 (= K161), E81 (= E193), V82 (= V194), T109 (= T221), I157 (= I268), G278 (= G387), D279 (= D388), S297 (≠ H403), V298 (≠ W404), F325 (= F431), W326 (= W432)
Sites not aligning to the query:
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
34% identity, 76% coverage: 120:508/510 of query aligns to 6:400/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G124), V11 (≠ A125), G12 (≠ A126), D34 (≠ R148), E35 (= E149), R42 (= R156), P43 (≠ T157), K47 (= K161), E78 (= E193), V79 (= V194), T106 (= T221), G107 (= G222), G273 (= G387), D274 (= D388), T290 (≠ H403), Y291 (≠ W404), W319 (= W432)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ K226), G149 (= G264), L152 (≠ F267), I153 (= I268), E156 (= E271), E172 (≠ A287), A173 (≠ R288), R180 (≠ A295), V236 (≠ I351), G237 (= G352), A238 (≠ V353), E289 (= E402), W319 (= W432), T320 (= T433)
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
34% identity, 76% coverage: 120:508/510 of query aligns to 7:401/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G124), V12 (≠ A125), G13 (≠ A126), D35 (≠ R148), E36 (= E149), R43 (= R156), P44 (≠ T157), S47 (= S160), K48 (= K161), V80 (= V194), T107 (= T221), G108 (= G222), R128 (= R242), G274 (= G387), D275 (= D388), T291 (≠ H403), Y292 (≠ W404), S319 (≠ F431), W320 (= W432)
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
30% identity, 70% coverage: 117:471/510 of query aligns to 3:360/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G122), G10 (= G124), H11 (≠ A125), A12 (= A126), D34 (≠ R148), E35 (= E149), R42 (= R156), P43 (≠ T157), S46 (= S160), K47 (= K161), R78 (≠ E193), M79 (≠ V194), T106 (= T221), R127 (= R242), I153 (= I268), D275 (= D388), S292 (≠ H403), V293 (≠ W404), W321 (= W432)
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
31% identity, 73% coverage: 119:488/510 of query aligns to 7:373/401 of 4h4uA
- active site: L13 (≠ A125), R44 (= R156), P45 (≠ T157), Q291 (= Q408)
- binding flavin-adenine dinucleotide: G12 (= G124), A14 (= A126), D36 (≠ R148), R44 (= R156), P45 (≠ T157), A78 (≠ T195), T105 (= T221), G106 (= G222), L125 (= L241), R126 (= R242), I152 (= I268), E155 (= E271), G268 (= G387), D269 (= D388), E285 (= E402), T286 (≠ H403), W287 (= W404), A290 (= A407), W316 (= W432)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ F267), I152 (= I268), E171 (≠ A287), R172 (= R288), Q173 (≠ H289), G230 (= G350), I231 (= I351), G232 (= G352), I284 (= I401), E285 (= E402), Y315 (≠ F431)
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
31% identity, 73% coverage: 119:488/510 of query aligns to 6:372/399 of 4h4wA
- active site: L12 (≠ A125), R43 (= R156), P44 (≠ T157), Q290 (= Q408)
- binding flavin-adenine dinucleotide: G11 (= G124), A13 (= A126), D35 (≠ R148), R43 (= R156), P44 (≠ T157), A77 (≠ T195), T104 (= T221), G105 (= G222), R125 (= R242), I151 (= I268), E154 (= E271), G267 (= G387), D268 (= D388), T285 (≠ H403), W286 (= W404), A289 (= A407), W315 (= W432)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (≠ D265), I151 (= I268), R171 (= R288), S177 (≠ A294), R178 (≠ A295), G229 (= G350), I230 (= I351), G231 (= G352)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
32% identity, 68% coverage: 117:463/510 of query aligns to 6:361/422 of P16640
- A15 (= A126) binding
- D37 (≠ R148) binding
- K50 (= K161) binding
- V83 (= V194) binding
- R134 (= R242) binding
- D284 (= D388) binding
- V302 (≠ W404) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
32% identity, 68% coverage: 117:463/510 of query aligns to 5:360/422 of 1q1wA
- active site: L13 (≠ A125), L44 (≠ R156), P45 (≠ T157), L305 (≠ Q408)
- binding flavin-adenine dinucleotide: G10 (= G122), G12 (= G124), L13 (≠ A125), A14 (= A126), G35 (≠ D147), D36 (≠ R148), L44 (≠ R156), P45 (≠ T157), K49 (= K161), V82 (= V194), A108 (= A220), T109 (= T221), G110 (= G222), R133 (= R242), I159 (= I268), D283 (= D388), S300 (≠ H403), V301 (≠ W404), W329 (= W432)
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
31% identity, 73% coverage: 119:488/510 of query aligns to 6:372/401 of 2gr2A
- active site: L12 (≠ A125), R43 (= R156), P44 (≠ T157), Q290 (= Q408)
- binding adenosine-5-diphosphoribose: R109 (≠ K226), V146 (≠ I263), G147 (= G264), G149 (≠ S266), V150 (≠ F267), I151 (= I268), E170 (≠ A287), T171 (≠ R288), R178 (≠ A295), G229 (= G350), I230 (= I351), G231 (= G352), E284 (= E402)
- binding flavin-adenine dinucleotide: G11 (= G124), A13 (= A126), D35 (≠ R148), E36 (= E149), R43 (= R156), P44 (≠ T157), K48 (= K161), A77 (≠ T195), T104 (= T221), G105 (= G222), R125 (= R242), G267 (= G387), D268 (= D388), T285 (≠ H403), W286 (= W404), A289 (= A407), W315 (= W432)
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
31% identity, 73% coverage: 119:488/510 of query aligns to 6:372/401 of 2gr0A
- active site: L12 (≠ A125), R43 (= R156), P44 (≠ T157), Q290 (= Q408)
- binding adenosine-5'-diphosphate: V146 (≠ I263), G147 (= G264), G149 (≠ S266), I151 (= I268), E170 (≠ A287), T171 (≠ R288), R178 (≠ A295), G229 (= G350), I230 (= I351), G231 (= G352)
- binding flavin-adenine dinucleotide: G11 (= G124), A13 (= A126), D35 (≠ R148), E36 (= E149), R43 (= R156), P44 (≠ T157), K48 (= K161), T76 (≠ V194), A77 (≠ T195), T104 (= T221), G105 (= G222), R125 (= R242), I151 (= I268), G267 (= G387), D268 (= D388), E284 (= E402), T285 (≠ H403), W286 (= W404), A289 (= A407), W315 (= W432)
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
31% identity, 73% coverage: 119:488/510 of query aligns to 7:373/402 of 2yvjA
- active site: L13 (≠ A125), R44 (= R156), P45 (≠ T157), Q291 (= Q408)
- binding flavin-adenine dinucleotide: G10 (= G122), G12 (= G124), G35 (≠ D147), D36 (≠ R148), E37 (= E149), R44 (= R156), P45 (≠ T157), A78 (≠ T195), T105 (= T221), G106 (= G222), R126 (= R242), G268 (= G387), D269 (= D388), T286 (≠ H403), W287 (= W404), A290 (= A407), W316 (= W432)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (≠ I263), G148 (= G264), G149 (≠ D265), G150 (≠ S266), I152 (= I268), V170 (≠ L286), E171 (≠ A287), T172 (≠ R288), R179 (≠ A295), G230 (= G350), I231 (= I351), G232 (= G352), V233 (= V353), E285 (= E402)
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
31% identity, 73% coverage: 119:488/510 of query aligns to 8:374/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G124), A15 (= A126), D37 (≠ R148), E38 (= E149), R45 (= R156), P46 (≠ T157), K50 (= K161), A79 (≠ T195), T106 (= T221), G107 (= G222), R127 (= R242), I153 (= I268), G269 (= G387), D270 (= D388), E286 (= E402), T287 (≠ H403), W288 (= W404), A291 (= A407), W317 (= W432)
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
31% identity, 73% coverage: 119:488/510 of query aligns to 7:373/401 of 1f3pA
- active site: L13 (≠ A125), R44 (= R156), P45 (≠ T157), Q291 (= Q408)
- binding flavin-adenine dinucleotide: A14 (= A126), V34 (≠ I146), D36 (≠ R148), E37 (= E149), R44 (= R156), P45 (≠ T157), A78 (≠ T195), T105 (= T221), G106 (= G222), R126 (= R242), G268 (= G387), D269 (= D388), E285 (= E402), T286 (≠ H403), W287 (= W404), A290 (= A407), W316 (= W432)
- binding nicotinamide-adenine-dinucleotide: V147 (≠ I263), G148 (= G264), G150 (≠ S266), V151 (≠ F267), I152 (= I268), E155 (= E271), E171 (≠ A287), T172 (≠ R288), R179 (≠ A295), G230 (= G350), I231 (= I351), G232 (= G352), V233 (= V353), E285 (= E402), W316 (= W432), S317 (≠ T433)
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
29% identity, 73% coverage: 119:488/510 of query aligns to 4:384/424 of 8c0zE
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 60% coverage: 141:444/510 of query aligns to 31:356/488 of Q9LK94
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 386 G→Q: In sdp2-3; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
5jcnA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
28% identity, 73% coverage: 141:510/510 of query aligns to 30:427/429 of 5jcnA
- active site: R45 (= R156), P46 (≠ T157), L61 (vs. gap), H65 (vs. gap), S70 (≠ E172), R317 (≠ Q408), F425 (= F508)
- binding ascorbic acid: P46 (≠ T157), G69 (≠ N171), R317 (≠ Q408), F346 (≠ W432)
- binding flavin-adenine dinucleotide: K37 (≠ R148), E38 (= E149), R45 (= R156), P46 (≠ T157), K50 (= K161), I93 (≠ V194), A119 (= A220), T120 (= T221), R144 (= R242), E145 (≠ S243), L262 (≠ A356), D295 (= D388), E311 (= E402), H312 (= H403), V313 (≠ W404), F346 (≠ W432)
- binding nicotinamide-adenine-dinucleotide: G170 (≠ S266), Y171 (≠ F267), I172 (= I268), P192 (≠ R288), G256 (= G350), V257 (≠ I351), G258 (= G352), E311 (= E402), H312 (= H403), F346 (≠ W432)
Sites not aligning to the query:
5jcmA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
28% identity, 73% coverage: 141:510/510 of query aligns to 30:427/429 of 5jcmA
- active site: R45 (= R156), P46 (≠ T157), L61 (vs. gap), H65 (vs. gap), S70 (≠ E172), R317 (≠ Q408), F425 (= F508)
- binding flavin-adenine dinucleotide: S36 (≠ D147), K37 (≠ R148), E38 (= E149), R45 (= R156), P46 (≠ T157), K50 (= K161), I93 (≠ V194), A119 (= A220), T120 (= T221), G121 (= G222), R144 (= R242), E145 (≠ S243), D295 (= D388), E311 (= E402), H312 (= H403), V313 (≠ W404), A316 (= A407), F346 (≠ W432)
- binding isoascorbic acid: E44 (≠ D155), P46 (≠ T157), K50 (= K161), G69 (≠ N171), R317 (≠ Q408), F346 (≠ W432)
- binding nicotinamide-adenine-dinucleotide: G170 (≠ S266), Y171 (≠ F267), I172 (= I268), E175 (= E271), P192 (≠ R288), G256 (= G350), V257 (≠ I351), G258 (= G352), E311 (= E402), H312 (= H403), F346 (≠ W432)
Sites not aligning to the query:
5jclA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
27% identity, 73% coverage: 141:510/510 of query aligns to 30:427/429 of 5jclA
- active site: R45 (= R156), P46 (≠ T157), L61 (vs. gap), H65 (vs. gap), S70 (≠ E172), R317 (≠ Q408), F425 (= F508)
- binding flavin-adenine dinucleotide: S36 (≠ D147), K37 (≠ R148), E38 (= E149), R45 (= R156), P46 (≠ T157), K50 (= K161), I93 (≠ V194), A119 (= A220), T120 (= T221), G121 (= G222), R144 (= R242), E145 (≠ S243), D295 (= D388), E311 (= E402), H312 (= H403), V313 (≠ W404), A316 (= A407), Y346 (≠ W432)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G170 (≠ S266), Y171 (≠ F267), I172 (= I268), E175 (= E271), P192 (= P290), R199 (≠ E299), G256 (= G350), V257 (≠ I351), G258 (= G352), E311 (= E402), H312 (= H403), Y346 (≠ W432)
Sites not aligning to the query:
5jciA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
27% identity, 73% coverage: 141:510/510 of query aligns to 30:430/432 of 5jciA
- active site: R45 (= R156), P46 (≠ T157), L61 (vs. gap), H65 (vs. gap), S70 (≠ E172), R317 (≠ Q408), F428 (= F508)
- binding flavin-adenine dinucleotide: S36 (≠ D147), K37 (≠ R148), E38 (= E149), R45 (= R156), P46 (≠ T157), K50 (= K161), I93 (≠ V194), A119 (= A220), T120 (= T221), G121 (= G222), R144 (= R242), E145 (≠ S243), Y171 (≠ F267), I172 (= I268), L262 (≠ A356), D295 (= D388), H312 (= H403), V313 (≠ W404), A316 (= A407), F345 (= F431), Y346 (≠ W432)
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_4027 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4027
MSLHQVARFADVREDRGLEVKIDDASILLLRSGDQVRAFQGKCPHAGAPLAKGAVCHGRL
ICPWHKAAFRTEDGALCEPPALDSLARYHVEVRDGDVWVDDQPLPTDKVPPADDARTFVI
IGAGAAGTACAAALREKGFGGRILMIDREAEAGYDRTVLSKYVLAGDMAVNETAPLRDET
YFTRQRIERLHGEVTHLDPDARQIQLADGRQLDYDAALIATGGEPKMPALPGIELPQVFV
LRSIAHARQILDTVRPGQQAVIIGDSFIAMEVASSLRKRGLDVTVLARHPVPFAAQMGES
VGQAILARHRANGVVYHTDGEAARIEGAHKVEAVVLDNGQRLAADLVIIGIGVHPATEPF
AGLPREQDQSLSVDAGMRVAEGVWAVGDIATFPLNGAPVRIEHWRLAQQQARIAAANMLG
GDERYLDVPFFWTYHFGKRYDYLGHAEHWDEVEFKGTPEHPPFIALLGKDGLVAAAVACD
EGRAMAALAQRMKQPLPVDEAWRLVRDFSS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory