Comparing Pf6N2E2_4085 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4085 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wngA Crystal structure of an aspartate ammonia-lyase from elizabethkingia anophelis nuhp1
61% identity, 97% coverage: 11:472/478 of query aligns to 3:463/466 of 6wngA
3oceA Crystal structure of fumarate lyase:delta crystallin from brucella melitensis bound to cobalt
61% identity, 96% coverage: 12:471/478 of query aligns to 3:460/461 of 3oceA
P0AC38 Aspartate ammonia-lyase; Aspartase; EC 4.3.1.1 from Escherichia coli (strain K12) (see 2 papers)
57% identity, 97% coverage: 10:471/478 of query aligns to 4:465/478 of P0AC38
3r6qA A triclinic-lattice structure of aspartase from bacillus sp. Ym55-1 (see paper)
50% identity, 96% coverage: 12:471/478 of query aligns to 2:458/462 of 3r6qA
3r6vG Crystal structure of aspartase from bacillus sp. Ym55-1 with bound l- aspartate (see paper)
50% identity, 96% coverage: 12:471/478 of query aligns to 3:459/463 of 3r6vG
P05042 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Escherichia coli (strain K12) (see 4 papers)
42% identity, 96% coverage: 10:469/478 of query aligns to 3:460/467 of P05042
1fupA Fumarase with bound pyromellitic acid (see paper)
42% identity, 96% coverage: 12:468/478 of query aligns to 1:455/455 of 1fupA
1fuqA Fumarase with bound 3-trimethylsilylsuccinic acid (see paper)
42% identity, 96% coverage: 12:468/478 of query aligns to 2:456/456 of 1fuqA
1fuoA FumarasE C with bound citrate (see paper)
42% identity, 96% coverage: 12:468/478 of query aligns to 2:456/456 of 1fuoA
P07954 Fumarate hydratase, mitochondrial; Fumarase; HsFH; EC 4.2.1.2 from Homo sapiens (Human) (see 4 papers)
41% identity, 98% coverage: 5:472/478 of query aligns to 44:510/510 of P07954
Sites not aligning to the query:
7lubB Crystal structure of recombinant human fumarase in complex with d-2- amino-3-phosphono-propionic acid (see paper)
41% identity, 97% coverage: 10:472/478 of query aligns to 1:462/462 of 7lubB
Q9ZCQ4 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Rickettsia prowazekii (strain Madrid E) (see paper)
40% identity, 96% coverage: 10:470/478 of query aligns to 3:461/461 of Q9ZCQ4
P08417 Fumarate hydratase, mitochondrial; Fumarase; EC 4.2.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
41% identity, 99% coverage: 2:472/478 of query aligns to 19:488/488 of P08417
Sites not aligning to the query:
7c18B Crystal structure of fumarasec from mannheimia succiniciproducens in complex with fumarate
41% identity, 96% coverage: 10:469/478 of query aligns to 2:460/464 of 7c18B
P9WN93 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
42% identity, 98% coverage: 2:470/478 of query aligns to 1:462/474 of P9WN93
4adlA Crystal structures of rv1098c in complex with malate (see paper)
43% identity, 96% coverage: 10:470/478 of query aligns to 1:454/459 of 4adlA
4apbD Crystal structure of mycobacterium tuberculosis fumarase (rv1098c) s318c in complex with fumarate (see paper)
42% identity, 96% coverage: 10:470/478 of query aligns to 1:454/462 of 4apbD
6s88A Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-((1,2,4,5-tetrahydro- 3h-benzo[d]azepin-3-yl)sulfonyl)phenyl)-2-(4-oxo-3,4- dihydrophthalazin-1-yl)acetamide (see paper)
41% identity, 96% coverage: 11:470/478 of query aligns to 1:445/450 of 6s88A
6s7wA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azepan-1-ylsulfonyl)-2- methoxyphenyl)-2-(quinolin-4-yl)acetamide (see paper)
41% identity, 96% coverage: 11:470/478 of query aligns to 1:445/450 of 6s7wA
6s7sA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-(n-phenylsulfamoyl) phenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
41% identity, 96% coverage: 11:470/478 of query aligns to 1:445/450 of 6s7sA
>Pf6N2E2_4085 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4085
MISIMSSAASFRTEKDLLGVLEVPAQAYYGIQTLRAVNNFRLSGVPISHYPKLVVGLAMV
KQAAADANRELGQLSEAKHAAISEACARLIRGDFHEEFVVDMIQGGAGTSTNMNANEVIA
NIALEAMGHQKGEYQYLHPNNDVNMAQSTNDAYPTAIRLGLLLGHDALLASLDSLIQAFA
AKGEEFSHVLKMGRTQLQDAVPMTLGQEFRAFATTLSEDLARLKTLAPELLTEVNLGGTA
IGTGINADPRYQALAVQRLATISGQPLVPAADLIEATSDMGAFVLFSGMLKRTAVKLSKI
CNDLRLLSSGPRTGINEINLPARQPGSSIMPGKVNPVIPEAVNQVAFQIIGNDLALTIAA
EGGQLQLNVMEPLIAFKIFDSIRLLQRAMDMLREHCIVGITANEARCRELVEHSIGLVTA
LNPYIGYENATRIARVALESGRGVLELVREEGLLDDAMLDDILRPENMIAPRLVPLKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory