SitesBLAST
Comparing Pf6N2E2_4232 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4232 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
37% identity, 99% coverage: 4:328/329 of query aligns to 7:341/346 of Q04797
- S98 (= S91) modified: Phosphoserine
- Y146 (≠ F138) modified: Phosphotyrosine
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
36% identity, 99% coverage: 3:327/329 of query aligns to 6:332/337 of P23247
- C132 (= C122) active site, Acyl-thioester intermediate
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
36% identity, 99% coverage: 3:327/329 of query aligns to 5:331/336 of 2r00C
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), V13 (= V13), A35 (= A32), S36 (= S33), S39 (= S36), T56 (≠ F53), S70 (≠ C67), A71 (≠ V68), G72 (≠ S69), N93 (= N89), T94 (≠ S90), N126 (= N121), C127 (= C122), G160 (= G155), M161 (≠ Q156), G328 (= G315)
- binding phthalic acid: S73 (≠ G70), T94 (≠ S90), S95 (= S91), R98 (= R94), N126 (= N121), K222 (= K207)
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (≠ S69), S73 (≠ G70), T94 (≠ S90), S95 (= S91), R98 (= R94), K222 (= K207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), V13 (= V13), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), S70 (≠ C67), A71 (≠ V68), G72 (≠ S69), T75 (≠ F72), N93 (= N89), T94 (≠ S90), N126 (= N121), C127 (= C122), G160 (= G155), G328 (= G315)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (≠ C67), G72 (≠ S69), S73 (≠ G70), N93 (= N89), T94 (≠ S90), S95 (= S91), R98 (= R94), K222 (= K207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), A71 (≠ V68), G160 (= G155), M161 (≠ Q156), G162 (≠ P157)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/357 of 4r3nA
- active site: C127 (= C122), Q154 (= Q149), R244 (= R229), H251 (= H236)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ G70), T94 (≠ S90), S95 (= S91), R98 (= R94), N126 (= N121), K222 (= K207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), V13 (= V13), A35 (= A32), S36 (= S33), S39 (= S36), T56 (≠ F53), S70 (≠ C67), A71 (≠ V68), G72 (≠ S69), N93 (= N89), T94 (≠ S90), N126 (= N121), C127 (= C122), G160 (= G155), M161 (≠ Q156), G328 (= G315)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R94), N126 (= N121), G158 (= G153), I208 (≠ V193), E219 (= E204), K222 (= K207), R244 (= R229)
- binding adenosine-2'-5'-diphosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), A71 (≠ V68), T75 (≠ F72), G160 (= G155), M161 (≠ Q156)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), A71 (≠ V68), T75 (≠ F72), G160 (= G155)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R94), N126 (= N121), G158 (= G153), A159 (= A154), E219 (= E204), K222 (= K207), R244 (= R229)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/357 of 2gz3A
- active site: C127 (= C122), Q154 (= Q149), R244 (= R229), H251 (= H236)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C122), Q154 (= Q149), G158 (= G153), E219 (= E204), R244 (= R229), H251 (= H236)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), V13 (= V13), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), S70 (≠ C67), A71 (≠ V68), G72 (≠ S69), T75 (≠ F72), N93 (= N89), G158 (= G153), G160 (= G155), M161 (≠ Q156), N324 (≠ Q311), A329 (= A316)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/357 of 2gz2A
- active site: C127 (= C122), Q154 (= Q149), R244 (= R229), H251 (= H236)
- binding adenosine-2'-5'-diphosphate: G8 (= G8), T10 (= T10), G11 (= G11), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), A71 (≠ V68), T75 (≠ F72)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/357 of 2gz1A
- active site: C127 (= C122), Q154 (= Q149), R244 (= R229), H251 (= H236)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), V13 (= V13), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), S70 (≠ C67), A71 (≠ V68), G72 (≠ S69), T75 (≠ F72), N93 (= N89), S157 (= S152), G158 (= G153), G160 (= G155), M161 (≠ Q156), N324 (≠ Q311), L325 (= L312)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/361 of 3pylC
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), A71 (≠ V68), T75 (≠ F72), G160 (= G155), M161 (≠ Q156), G162 (≠ P157)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R94), N126 (= N121), C127 (= C122), Q154 (= Q149), G158 (= G153), E219 (= E204), K222 (= K207), R244 (= R229)
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ G70), T94 (≠ S90), S95 (= S91), R98 (= R94), N126 (= N121), C127 (= C122), Q154 (= Q149), G158 (= G153), K222 (= K207), R244 (= R229), H251 (= H236)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), V13 (= V13), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), S70 (≠ C67), A71 (≠ V68), G72 (≠ S69), T75 (≠ F72), N93 (= N89), T94 (≠ S90), P125 (= P120), N126 (= N121), C127 (= C122), G160 (= G155), M161 (≠ Q156), G328 (= G315)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ S90), S95 (= S91), R98 (= R94), N126 (= N121), C127 (= C122), Q154 (= Q149), G158 (= G153), E219 (= E204), K222 (= K207), R244 (= R229), H251 (= H236)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), V13 (= V13), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), S70 (≠ C67), A71 (≠ V68), G72 (≠ S69), T75 (≠ F72), N93 (= N89), T94 (≠ S90), N126 (= N121), C127 (= C122), G160 (= G155), M161 (≠ Q156), G328 (= G315)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
34% identity, 98% coverage: 4:327/329 of query aligns to 4:340/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R94), G158 (= G153), E219 (= E204), K222 (= K207), R244 (= R229)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (= T10), G11 (= G11), A12 (= A12), V13 (= V13), A35 (= A32), S36 (= S33), R38 (= R35), S39 (= S36), T56 (≠ F53), S70 (≠ C67), A71 (≠ V68), G72 (≠ S69), T75 (≠ F72), C127 (= C122), S157 (= S152), G158 (= G153), G160 (= G155), M161 (≠ Q156), N324 (≠ Q311), L325 (= L312)
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
35% identity, 99% coverage: 4:329/329 of query aligns to 4:342/342 of 3tz6A
- active site: C129 (= C122), Q156 (= Q149), R248 (= R229), H255 (= H236)
- binding cysteine: C129 (= C122), Q156 (= Q149), G160 (= G153), E223 (= E204), R248 (= R229), H255 (= H236)
- binding glycerol: S108 (≠ P104), G187 (vs. gap), F192 (vs. gap), P201 (≠ N184), Q225 (≠ M206), R228 (≠ V209), F229 (≠ W210), Q335 (≠ E322), E338 (≠ Q325), L339 (= L326)
- binding sulfate ion: R98 (= R94), H117 (≠ G113), R119 (≠ K115), N128 (= N121), C129 (= C122), K226 (= K207), E270 (= E252), R273 (= R255)
5bntC X-ray crystal structure of a aspartate-semialdehyde dehydrogenase bound to NADP from pseudomonas aeruginosa
29% identity, 96% coverage: 1:317/329 of query aligns to 2:358/371 of 5bntC
- active site: C136 (= C122), Q163 (= Q149), R269 (= R229), H276 (= H236)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), R11 (≠ T10), G12 (= G11), M13 (≠ A12), V14 (= V13), T38 (≠ S33), S39 (≠ G34), Q74 (≠ V68)
Query Sequence
>Pf6N2E2_4232 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4232
MKKVAVVGCTGAVGMTMLQLLENTDYEVVCMASGRSAGKRLKVGQVEHLIEAFSVEGCAS
CDIVFLCVSGAFALEYGERLAENAYVIDNSSAFRYHPAIPLLVPPINGQRYMGEKLIANP
NCSSAIALMVLGPLHQAFGLESAIISTYQAASGAGQPAMLELREKAKSFSDYGDRDDSEH
FAHNLAFNVIPQVDSFEANGYTREEMKVVWELRKVLDEPTLAISTTAVRVPTLRSHAESL
SLRFNTPIQSLEQVRELLRSAPGVEVVDEPEFGAYPMPMTSTYKHAVEVGRIRYNLIYGE
HGLDLFISGDQLLRGAALNAFEIMQLIKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory