SitesBLAST
Comparing Pf6N2E2_4408 2-Keto-D-gluconate dehydrogenase (EC 1.1.99.4), membrane-bound, cytochrome c to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
48% identity, 84% coverage: 46:444/474 of query aligns to 2:412/413 of 8jejC
- binding heme c: C13 (= C57), C16 (= C60), H17 (= H61), T42 (= T85), I44 (= I87), F60 (= F103), L64 (≠ V107), L75 (= L118), Y76 (= Y119), M79 (= M122), P80 (= P123), Y84 (= Y127), R122 (= R165), C162 (= C204), C165 (= C207), H166 (= H208), I186 (≠ L228), W189 (= W231), A191 (= A233), P192 (= P234), I194 (= I236), W205 (= W247), Y213 (= Y255), R223 (≠ Q266), M228 (= M271), V303 (≠ T338), C304 (= C339), C307 (= C342), H308 (= H343), Y320 (= Y353), P321 (= P354), L323 (= L356), T327 (= T360), T328 (≠ A361), D336 (≠ N367), I341 (= I372), V345 (= V376), R347 (= R378), I354 (= I385), M356 (= M387), F359 (= F390), I376 (≠ V408)
- binding ubiquinone-10: M36 (= M79), P77 (= P120), S124 (= S167), W128 (= W171), C165 (= C207), L173 (≠ M215), L408 (≠ I440), L411 (= L443)
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
48% identity, 84% coverage: 46:444/474 of query aligns to 2:398/418 of 7w2jC
- binding heme c: C13 (= C57), C16 (= C60), H17 (= H61), T42 (= T85), I44 (= I87), Y55 (= Y98), L75 (= L118), Y76 (= Y119), A78 (= A121), M79 (= M122), R122 (= R165), H161 (= H203), C162 (= C204), C165 (= C207), H166 (= H208), A191 (= A233), P192 (= P234), R223 (≠ Q266), P227 (= P270), M228 (= M271), V289 (≠ T338), C290 (= C339), C293 (= C342), H294 (= H343), Y305 (vs. gap), Y306 (= Y353), P307 (= P354), L309 (= L356), N312 (= N359), T313 (= T360), T314 (≠ A361), D322 (≠ N367), I327 (= I372), V331 (= V376), R333 (= R378), I340 (= I385), M342 (= M387), P343 (= P388), F345 (= F390)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
35% identity, 89% coverage: 23:442/474 of query aligns to 20:442/478 of Q47945
- Q37 (≠ E39) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
36% identity, 83% coverage: 48:442/474 of query aligns to 9:404/433 of 8gy2B
- binding heme c: C18 (= C57), C21 (= C60), H22 (= H61), T46 (= T85), I48 (= I87), Y59 (= Y98), L68 (≠ V107), R73 (≠ T112), V79 (≠ L118), Y80 (= Y119), M83 (= M122), F88 (≠ Y127), R126 (= R165), H165 (= H203), C166 (= C204), C169 (= C207), H170 (= H208), I201 (≠ Y232), A202 (= A233), P203 (= P234), L205 (≠ I236), W216 (= W247), F224 (≠ Y255), A234 (= A265), V235 (≠ Q266), F236 (≠ A267), F236 (≠ A267), M239 (= M271), N301 (≠ T338), C302 (= C339), C305 (= C342), H306 (= H343), M316 (≠ E352), F317 (≠ Y353), P318 (= P354), L320 (= L356), P324 (≠ T360), G342 (= G375), S352 (vs. gap), V354 (≠ I385), M356 (= M387), F359 (= F396), M375 (≠ V412)
- binding ubiquinone-10: C21 (= C60), L34 (≠ Y73), P39 (= P78), P81 (= P120), L129 (≠ M168), W132 (= W171), E168 (≠ T206), R173 (= R211), I197 (≠ L228), D241 (≠ E273)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
34% identity, 77% coverage: 46:412/474 of query aligns to 42:407/440 of 8gy3A
- binding heme c: Y52 (≠ D56), C53 (= C57), C56 (= C60), H57 (= H61), S84 (≠ T85), I86 (= I87), W97 (≠ Y98), F102 (= F103), L117 (= L118), F121 (≠ M122), F126 (≠ Y127), R163 (= R165), C203 (= C204), C206 (= C207), H207 (= H208), A232 (= A233), P233 (= P234), L235 (≠ I236), W245 (= W247), Y253 (= Y255), L254 (= L256), G263 (≠ A265), S264 (≠ Q266), M269 (= M271), Y292 (≠ L294), C337 (= C339), C340 (= C342), H341 (= H343), P353 (= P354), L355 (= L356), N358 (= N359), N359 (≠ T360), V372 (≠ T371), I377 (≠ V376), G382 (≠ D381), Q383 (≠ G382), I386 (= I385), M388 (= M387), F391 (= F390)
- binding ubiquinone-10: E55 (≠ A59), T76 (≠ S77), F78 (≠ M79), Y118 (= Y119), P119 (= P120), I160 (≠ F162), G166 (≠ M168), Q167 (≠ L169), F169 (vs. gap), W170 (= W171), H202 (= H203), R210 (= R211), L213 (= L214)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
40% identity, 26% coverage: 312:432/474 of query aligns to 1:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C339), C33 (= C342), H34 (= H343), Y46 (= Y353), P47 (= P354), T54 (≠ A361), V66 (≠ T371), I67 (= I372), R73 (= R378), I80 (= I385), M82 (= M387), P83 (= P388)
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
33% identity, 22% coverage: 327:432/474 of query aligns to 349:453/456 of 5oboA
- binding heme c: T360 (= T338), C361 (= C339), C364 (= C342), H365 (= H343), P377 (≠ H358), P378 (≠ N359), L379 (≠ T360), S382 (= S363), F384 (≠ N367), I395 (≠ T371), N401 (≠ H377), G402 (≠ R378), S413 (vs. gap), M415 (= M387), M418 (≠ F390)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
33% identity, 22% coverage: 327:432/474 of query aligns to 348:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (= T338), C360 (= C339), C363 (= C342), H364 (= H343), P376 (≠ H358), P377 (≠ N359), L378 (≠ T360), F383 (≠ N367), N400 (≠ H377), G401 (≠ R378), Y410 (≠ I385), S412 (vs. gap), M414 (= M387), M417 (≠ F390)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
33% identity, 22% coverage: 327:432/474 of query aligns to 351:455/457 of 4ax3D
- binding heme c: C363 (= C339), C366 (= C342), H367 (= H343), P379 (≠ H358), P380 (≠ N359), L381 (≠ T360), S384 (= S363), F386 (≠ N367), N403 (≠ H377), G404 (≠ R378), S415 (vs. gap), M417 (= M387), M420 (≠ F390)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
31% identity, 22% coverage: 331:432/474 of query aligns to 339:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C339), C350 (= C342), H351 (= H343), F362 (≠ Y353), P363 (= P354), P364 (≠ S355), L365 (= L356), S368 (≠ R365), Y370 (≠ N367), I382 (≠ E379), L386 (≠ V383), S387 (≠ A384), G388 (= G391), I390 (vs. gap), V392 (vs. gap), Y397 (vs. gap), N398 (vs. gap), G399 (= G393), V400 (≠ A394), M401 (≠ L395)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
P00107 Cytochrome c6; Cytochrome c-553; Cytochrome c553; Soluble cytochrome f from Diacronema lutheri (Unicellular marine alga) (Monochrysis lutheri) (see paper)
35% identity, 18% coverage: 331:417/474 of query aligns to 6:83/83 of P00107
- C14 (= C339) binding covalent
- C17 (= C342) binding covalent
- K24 (≠ G349) modified: N6-methyllysine; partial
Query Sequence
>Pf6N2E2_4408 2-Keto-D-gluconate dehydrogenase (EC 1.1.99.4), membrane-bound, cytochrome c
MYPQRRDQPLPGVGKVKSMRNMLAGGLALMTISLATHGETLDTSASPGKRLAVAADCVAC
HSTVGGKPFAGGYPLNSPMGTIYSTNITPSRSAGIGQYTQADFARAVRDGVTPDGTHLYP
AMPYTSYAKMTDSDVAALYQYFMDEVEPVDTPSPKTELDFPFNIRASMLGWNALFHRQKR
FEADPGKSAQVNRGDYLVNALAHCDTCHTPRNVLMAADNAKALSGGSLGAWYAPNITSDK
TSGIGAWSSDELVAYLRSGHVEGKAQAAGPMAEAVEHSLQYLGEEDLKAIAAYLLQTQPI
ATGERQARHTFGQASNDELNLRGGKPQDNPGWHIFSGTCANCHQANGEGTREYPSLFHNT
ATSRRDNLIATIVYGVHREVDGVAIDMPAFGPGALFTDRLDDQQIADVSNYVLSRYGNAG
LNVTAADVAQVREGGPKAPIAVLARYSVPALVVLGLLIILGLYRLKARRRLQEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory