Comparing Pf6N2E2_4513 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4513 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
Q9I6J1 Putrescine-binding periplasmic protein SpuD from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
77% identity, 97% coverage: 11:375/375 of query aligns to 2:367/367 of Q9I6J1
3ttmA Crystal structure of spud in complex with putrescine (see paper)
78% identity, 91% coverage: 34:374/375 of query aligns to 1:341/341 of 3ttmA
P31133 Putrescine-binding periplasmic protein PotF from Escherichia coli (strain K12) (see 3 papers)
56% identity, 100% coverage: 1:375/375 of query aligns to 1:370/370 of P31133
Q9I6J0 Spermidine-binding periplasmic protein SpuE from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
58% identity, 96% coverage: 15:375/375 of query aligns to 6:365/365 of Q9I6J0
6ye7A E.Coli's putrescine receptor potf complexed with cadaverine (see paper)
59% identity, 90% coverage: 36:374/375 of query aligns to 2:341/341 of 6ye7A
6ye6A E.Coli's putrescine receptor potf complexed with agmatine (see paper)
59% identity, 90% coverage: 36:374/375 of query aligns to 2:341/341 of 6ye6A
6ye0B E.Coli's putrescine receptor potf complexed with putrescine (see paper)
59% identity, 90% coverage: 36:374/375 of query aligns to 2:341/341 of 6ye0B
1a99A Putrescine receptor (potf) from e. Coli (see paper)
59% identity, 90% coverage: 36:374/375 of query aligns to 2:341/341 of 1a99A
8aszA Potf with mutations s87y and a182d in complex with agmatine
58% identity, 91% coverage: 33:374/375 of query aligns to 1:343/343 of 8aszA
7oyxB E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y s247d in complex with spermidine (see paper)
58% identity, 91% coverage: 36:375/375 of query aligns to 2:342/347 of 7oyxB
7oywA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l s247d in complex with spermidine (see paper)
58% identity, 91% coverage: 36:375/375 of query aligns to 2:342/348 of 7oywA
7oyvA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88a s247d in complex with spermidine (see paper)
58% identity, 90% coverage: 36:374/375 of query aligns to 2:341/341 of 7oyvA
Sites not aligning to the query:
3ttnA Crystal structures of polyamine receptors spud and spue from pseudomonas aeruginosa (see paper)
58% identity, 89% coverage: 38:372/375 of query aligns to 2:335/335 of 3ttnA
P0AFK9 Spermidine/putrescine-binding periplasmic protein; SPBP from Escherichia coli (strain K12) (see 3 papers)
34% identity, 93% coverage: 27:375/375 of query aligns to 18:348/348 of P0AFK9
Sites not aligning to the query:
1poy1 Spermidine/putrescine-binding protein complexed with spermidine (dimer form) (see paper)
34% identity, 91% coverage: 35:375/375 of query aligns to 1:323/323 of 1poy1
7xjnA Structure of vcpotd1 in complex with norspermidine
33% identity, 83% coverage: 35:346/375 of query aligns to 2:295/322 of 7xjnA
Sites not aligning to the query:
4eqbA 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes
30% identity, 83% coverage: 38:350/375 of query aligns to 4:297/323 of 4eqbA
Sites not aligning to the query:
>Pf6N2E2_4513 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4513
MKALGMKTLGMKIAGKTLLAMSLMGVMAGAVQADDKVLHVYNWSDYIAPDTVAKFEKESG
IKVVYDVFDSNETLEAKLLAGKSGYDIVVPSNNFLAKQIKAGVYQKLDKSKLPNWKNLNT
DLLKAVSVSDPGNEHAFPYMWGSIGIGFNPEKVKAALGADAPTNSWDLLFKPENAAKLKA
CGISFLDSPTEMIPVALHYLGYPTDSQDKKQLAEAEALFLKIRPSIGYFHSSKYISDLAN
GNICVAVGYSGDIYQAKSRAAEAGGKVKVSYNIPKEGAGSFFDMVAIPKDAENVEGAYKF
MTFLQKPEIMAEITDTVSFPNGNAASTPLVSKEITSDPGIYPPADVQAKLYAIADLPAAT
QRILTRSWTKIKSGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory