Comparing Pf6N2E2_4810 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4810 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4y7uA Structural analysis of muru (see paper)
77% identity, 98% coverage: 1:219/223 of query aligns to 1:219/224 of 4y7uA
Q88QT2 N-acetylmuramate alpha-1-phosphate uridylyltransferase; MurNAc-1P uridylyltransferase; MurNAc-alpha-1P uridylyltransferase; EC 2.7.7.99 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
77% identity, 98% coverage: 1:219/223 of query aligns to 1:219/223 of Q88QT2
4y7vA Structural analysis of muru (see paper)
76% identity, 98% coverage: 1:219/223 of query aligns to 1:214/216 of 4y7vA
P74285 UTP--glucose-1-phosphate uridylyltransferase; Cyanobacterial UDP-glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDP-Glc PPase; EC 2.7.7.9 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
31% identity, 93% coverage: 1:207/223 of query aligns to 1:233/388 of P74285
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
30% identity, 93% coverage: 1:207/223 of query aligns to 1:220/360 of 7d73E
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
30% identity, 93% coverage: 1:207/223 of query aligns to 1:220/360 of 7d72K
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
30% identity, 93% coverage: 1:207/223 of query aligns to 1:220/360 of 7d72E
7whsA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gtp (see paper)
30% identity, 93% coverage: 1:207/223 of query aligns to 1:220/366 of 7whsA
7whtA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gdp-mannose (see paper)
38% identity, 52% coverage: 1:117/223 of query aligns to 1:120/360 of 7whtA
Sites not aligning to the query:
7d72A Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
35% identity, 61% coverage: 1:136/223 of query aligns to 2:162/407 of 7d72A
Sites not aligning to the query:
7d73B Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
35% identity, 61% coverage: 1:136/223 of query aligns to 2:162/406 of 7d73B
Sites not aligning to the query:
7x8kA Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
30% identity, 93% coverage: 1:207/223 of query aligns to 1:220/365 of 7x8kA
7x8kB Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
30% identity, 93% coverage: 1:207/223 of query aligns to 1:221/367 of 7x8kB
O22287 Mannose-1-phosphate guanylyltransferase 1; GDP-mannose pyrophosphorylase 1; Protein CYTOKINESIS DEFECTIVE 1; Protein EMBRYO DEFECTIVE 101; Protein HYPERSENSITIVE TO AMMONIUM ION 1; Protein SENSITIVE TO OZONE 1; Protein VITAMIN C DEFECTIVE 1; EC 2.7.7.13 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
30% identity, 93% coverage: 1:207/223 of query aligns to 1:221/361 of O22287
Sites not aligning to the query:
3hl3A 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose.
26% identity, 98% coverage: 1:218/223 of query aligns to 2:233/246 of 3hl3A
4ecmA 2.3 angstrom crystal structure of a glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with thymidine-5-diphospho-alpha-d-glucose and pyrophosphate (see paper)
26% identity, 98% coverage: 1:218/223 of query aligns to 3:234/245 of 4ecmA
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
26% identity, 98% coverage: 2:219/223 of query aligns to 13:248/302 of 4b2xB
Sites not aligning to the query:
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
26% identity, 98% coverage: 2:219/223 of query aligns to 7:242/296 of 5fyeA
Sites not aligning to the query:
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
26% identity, 98% coverage: 2:219/223 of query aligns to 7:242/296 of 5fu0A
Sites not aligning to the query:
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
26% identity, 98% coverage: 2:219/223 of query aligns to 7:242/296 of 5ftvA
Sites not aligning to the query:
>Pf6N2E2_4810 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4810
MKAMILAAGKGERMRPLTLTTPKPLIRVGGVPLIEYHLRALARAGFTEIVINHAWLGQQI
EDHLGDGARFGVSIRFSPEGEPLETGGGIFRALPLLGDEAFVVVNGDVWTDYDFSALRRP
LEGLAHLVLVDNPEHHPDGDFVLVDGKVHDRHAPADNLTYSGIAVLHPRLFDGCADGAFK
LAPLLRAAMAEGRVSGEHLKGHWVDVGTHERLAQVETLIEASG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory