SitesBLAST
Comparing Pf6N2E2_4825 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4825 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yi7A Anthranilate bound at active site of anthranilate phosphoribosyl transferase from acinetobacter (anprt; trpd)
57% identity, 98% coverage: 2:344/349 of query aligns to 3:330/331 of 4yi7A
1zxyA Anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium (see paper)
37% identity, 96% coverage: 1:336/349 of query aligns to 1:326/344 of 1zxyA
- binding magnesium ion: D223 (= D227), E224 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: A78 (≠ V81), G79 (= G82), D83 (= D86), T87 (≠ I90), N89 (= N92), S91 (= S94), T92 (= T95), K106 (= K110), S118 (= S122), D223 (= D227), E224 (= E228)
2gvqD Anthranilate phosphoribosyl-transferase (trpd) from s. Solfataricus in complex with anthranilate (see paper)
37% identity, 96% coverage: 1:336/349 of query aligns to 1:326/345 of 2gvqD
P50384 Anthranilate phosphoribosyltransferase; EC 2.4.2.18 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
37% identity, 96% coverage: 1:336/349 of query aligns to 1:326/345 of P50384
- T87 (≠ I90) binding
- K106 (= K110) mutation to Q: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency dedreases only 10-fold.
- H107 (= H111) mutation to A: Limited effect on either affinity for anthranilate and catalytic efficiency. 300-fold decrease of the affinity for anthranilate, whereas catalytic efficiency remains nearly unchanged; when associated with A-178.
- S118 (= S122) binding
- H154 (= H158) mutation to A: Limited effect on either affinity for anthranilate and catalytic efficiency.
- R164 (= R168) mutation to A: Strong decrease of the affinity for anthranilate, although only a moderate 7-fold decrease in catalytic efficiency.
- D223 (= D227) mutation to N: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency is unchanged.
- E224 (= E228) mutation to Q: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency is unchanged.
1kgzB Crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum) (see paper)
38% identity, 95% coverage: 7:338/349 of query aligns to 6:329/330 of 1kgzB
- binding manganese (ii) ion: S92 (= S94), D222 (= D227), E223 (= E228), E223 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V79 (= V81), G82 (= G84), G83 (= G85), N90 (= N92), I91 (≠ V93), S92 (= S94), T93 (= T95), K108 (= K110), S118 (= S122)
1gxbA Anthranilate phosphoribosyltransferase in complex with pyrophosphate and magnesium (see paper)
36% identity, 96% coverage: 1:336/349 of query aligns to 1:322/339 of 1gxbA
5nofA Anthranilate phosphoribosyltransferase from thermococcus kodakaraensis (see paper)
38% identity, 96% coverage: 7:340/349 of query aligns to 4:323/325 of 5nofA
3gbrA Anthranilate phosphoribosyl-transferase (trpd) double mutant d83g f149s from s. Solfataricus (see paper)
36% identity, 96% coverage: 1:336/349 of query aligns to 1:323/341 of 3gbrA
- binding manganese (ii) ion: S91 (= S94), D220 (= D227), E221 (= E228), E221 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: A78 (≠ V81), G79 (= G82), T80 (= T83), G81 (= G84), N89 (= N92), V90 (= V93), S91 (= S94), T92 (= T95), K106 (= K110), G114 (= G121)
4n93A Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
38% identity, 95% coverage: 7:339/349 of query aligns to 8:342/346 of 4n93A
- active site: V83 (= V81)
- binding 2-amino-6-methylbenzoic acid: V83 (= V81), G84 (= G82), T85 (= T83), H113 (= H111), N115 (= N113), N115 (= N113), A156 (= A154), P157 (≠ Q155), H160 (= H158), Y163 (≠ M161), A167 (= A165), R170 (= R168), G183 (= G181), P184 (= P182)
- binding magnesium ion: S96 (= S94), D228 (= D227), E229 (= E228), E229 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G82), G86 (= G84), G87 (= G85), N94 (= N92), S96 (= S94), T97 (= T95), K112 (= K110), A117 (= A115), A118 (≠ V116), S120 (≠ G118), G123 (= G121)
3r88B Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs145) (see paper)
38% identity, 95% coverage: 7:339/349 of query aligns to 7:340/344 of 3r88B
- active site: V82 (= V81)
- binding 2-amino-4,5-dimethoxybenzoic acid: N114 (= N113), A155 (= A154), P156 (≠ Q155), H159 (= H158), Y162 (≠ M161), R163 (≠ K162), A166 (= A165)
- binding magnesium ion: S95 (= S94), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V82 (= V81), G83 (= G82), G85 (= G84), G86 (= G85), N93 (= N92), S95 (= S94), T96 (= T95), K111 (= K110), N114 (= N113), A117 (≠ V116), S118 (= S117), S119 (≠ G118)
5c1rA Stereoisomer of prpp bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyl (anprt; trpd)
38% identity, 95% coverage: 7:339/349 of query aligns to 7:340/343 of 5c1rA
- active site: V82 (= V81)
- binding 5-O-[(R)-hydroxy(phosphonooxy)phosphoryl]-1-O-phosphono-alpha-D-ribofuranose: V82 (= V81), G83 (= G82), G86 (= G85), N93 (= N92), S95 (= S94), T96 (= T95), K111 (= K110), R115 (= R114), A117 (≠ V116), S118 (= S117), S119 (≠ G118)
- binding magnesium ion: D87 (= D86), V89 (≠ A88), S95 (= S94), E228 (= E228)
4n5vA Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
38% identity, 95% coverage: 7:339/349 of query aligns to 9:343/347 of 4n5vA
- active site: V84 (= V81)
- binding 2-amino-4-fluorobenzoic acid: V84 (= V81), G85 (= G82), H114 (= H111), G115 (= G112), N116 (= N113), A157 (= A154), A157 (= A154), P158 (≠ Q155), H161 (= H158), Y164 (≠ M161), R165 (≠ K162), A168 (= A165), R171 (= R168), G184 (= G181)
- binding magnesium ion: S97 (= S94), D229 (= D227), E230 (= E228), E230 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G85 (= G82), G87 (= G84), G88 (= G85), N95 (= N92), S97 (= S94), T98 (= T95), K113 (= K110), A119 (≠ V116), S120 (= S117), S121 (≠ G118), G124 (= G121)
4owoA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 6-fluoroanthranilate, prpp and magnesium (see paper)
38% identity, 95% coverage: 7:339/349 of query aligns to 9:344/348 of 4owoA
- active site: V84 (= V81)
- binding 2-azanyl-6-fluoranyl-benzoic acid: V84 (= V81), G85 (= G82), T86 (= T83), H114 (= H111), N116 (= N113), N116 (= N113), A157 (= A154), P158 (≠ Q155), H161 (= H158), Y164 (≠ M161), A168 (= A165), R171 (= R168), G184 (= G181)
- binding magnesium ion: S97 (= S94), D229 (= D227), E230 (= E228), E230 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V84 (= V81), G85 (= G82), G87 (= G84), G88 (= G85), N95 (= N92), S97 (= S94), T98 (= T95), K113 (= K110), A118 (= A115), A119 (≠ V116), S120 (= S117), S121 (≠ G118), G124 (= G121)
4giuA Bianthranilate-like analogue bound in inner site of anthranilate phosphoribosyltransferase (anprt; trpd). (see paper)
38% identity, 95% coverage: 7:339/349 of query aligns to 8:343/346 of 4giuA
- active site: V83 (= V81)
- binding 2-[(2-carboxy-5-methylphenyl)amino]-3-methylbenzoic acid: G114 (= G112), N115 (= N113), A156 (= A154), H160 (= H158), Y163 (≠ M161), R170 (= R168), G183 (= G181)
- binding magnesium ion: S96 (= S94), D228 (= D227), E229 (= E228), E229 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G82), G86 (= G84), G87 (= G85), N94 (= N92), S96 (= S94), T97 (= T95), K112 (= K110), N115 (= N113), A117 (= A115), A118 (≠ V116), S119 (= S117), S120 (≠ G118), G123 (= G121)
P9WFX5 Anthranilate phosphoribosyltransferase; EC 2.4.2.18 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
38% identity, 95% coverage: 7:339/349 of query aligns to 31:366/370 of P9WFX5
- G107 (= G82) binding
- T115 (≠ I90) binding
- G147 (≠ S122) binding
4owuA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 5-methylanthranilate, prpp and magnesium (see paper)
38% identity, 95% coverage: 7:339/349 of query aligns to 8:343/347 of 4owuA
- active site: V83 (= V81)
- binding 2-azanyl-5-methyl-benzoic acid: N115 (= N113), P157 (≠ Q155), Y163 (≠ M161), R164 (≠ K162), A167 (= A165)
- binding magnesium ion: S96 (= S94), D228 (= D227), E229 (= E228), E229 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G82), G86 (= G84), G87 (= G85), N94 (= N92), S96 (= S94), T97 (= T95), K112 (= K110), A118 (≠ V116), S120 (≠ G118), G123 (= G121)
4owqA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-methylanthranilate, prpp and magnesium (see paper)
38% identity, 95% coverage: 7:339/349 of query aligns to 8:343/347 of 4owqA
- active site: V83 (= V81)
- binding 2-azanyl-3-methyl-benzoic acid: P157 (≠ Q155), H160 (= H158), Y163 (≠ M161), A167 (= A165), R171 (= R169)
- binding magnesium ion: S96 (= S94), D228 (= D227), E229 (= E228), E229 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V83 (= V81), G84 (= G82), G86 (= G84), G87 (= G85), N94 (= N92), S96 (= S94), T97 (= T95), K112 (= K110), A117 (= A115), A118 (≠ V116), S120 (≠ G118), G123 (= G121)
4zokA Methylsulfonyl-containing inhibitor bound in the substrate capture site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
38% identity, 95% coverage: 7:339/349 of query aligns to 7:339/342 of 4zokA
- active site: V82 (= V81)
- binding 4-methyl-2-{[2-methyl-6-(methylsulfonyl)phenyl]amino}benzoic acid: P156 (≠ Q155), R163 (≠ K162), A166 (= A165), A167 (= A166)
- binding magnesium ion: S95 (= S94), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G86 (= G85), N93 (= N92), S95 (= S94), T96 (= T95), K111 (= K110), A116 (= A115), A117 (≠ V116), S119 (≠ G118), G122 (= G121)
4zofA Lobenzarit-like inhibitor bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
38% identity, 95% coverage: 7:339/349 of query aligns to 7:339/342 of 4zofA
- active site: V82 (= V81)
- binding 2-[(2-carboxy-5-nitrophenyl)amino]-3-methylbenzoic acid: G113 (= G112), N114 (= N113), A155 (= A154), H159 (= H158), Y162 (≠ M161), R169 (= R168), G182 (= G181)
- binding magnesium ion: S95 (= S94), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G82), G85 (= G84), G86 (= G85), N93 (= N92), S95 (= S94), T96 (= T95), K111 (= K110), A116 (= A115), A117 (≠ V116), S119 (≠ G118), G122 (= G121)
4owmA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-fluoroanthranilate, prpp and magnesium (see paper)
38% identity, 95% coverage: 7:339/349 of query aligns to 7:342/346 of 4owmA
- active site: V82 (= V81)
- binding 2-azanyl-3-fluoranyl-benzoic acid: P156 (≠ Q155), H159 (= H158), Y162 (≠ M161), R163 (≠ K162), A166 (= A165), R170 (= R169)
- binding magnesium ion: S95 (= S94), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G82), G86 (= G85), N93 (= N92), S95 (= S94), T96 (= T95), K111 (= K110), A117 (≠ V116), S118 (= S117), S119 (≠ G118), G122 (= G121)
Query Sequence
>Pf6N2E2_4825 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4825
MDIKTALSRIVGHLDLSTDEMRDVMREIMTGQCTDAQIGAFMMAMRMKSESIDEIVGAVS
AMRELADKVELKTLDGVVDVVGTGGDGANIFNVSTASSFVVAAAGCTVAKHGNRAVSGKS
GSADLLEAAGIYLNLTPVQVARCIDNVGIGFMFAQTHHSAMKHAAAPRRELGLRTLFNML
GPLTNPAGVKHQVVGVFSQALCRPLAEVLQRLGSKHVLVVHSKDGLDEFSLAAPTFVAEL
KNDQISEYWVEPEDLGMKSQSLHGLAVDSPAQSLELIRDALGRRKTENGQKAAEMIVLNA
GAALYAADHASSLKQGVELAHDALHTGLAREKLEELGAFTAVFKVENEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory