SitesBLAST
Comparing Pf6N2E2_489 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_489 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
53% identity, 93% coverage: 12:266/273 of query aligns to 3:257/265 of Q7CRQ0
- Y134 (= Y144) mutation to A: 0.1% of wild-type activity.
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
52% identity, 94% coverage: 10:266/273 of query aligns to 2:258/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (= S83), S110 (= S119), N111 (= N120), H112 (= H121), Y135 (= Y144), S164 (= S173), R173 (= R182), F257 (= F265)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G17), G12 (= G20), Q13 (≠ G21), L14 (= L22), D33 (= D41), L34 (≠ I42), D50 (= D59), L51 (= L60), L70 (≠ F79), G71 (= G80), G72 (= G81), S74 (= S83), A108 (= A117), S110 (= S119), Y135 (= Y144), K139 (= K148), I162 (= I171), S164 (= S173), C165 (≠ S174)
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
52% identity, 94% coverage: 10:266/273 of query aligns to 2:258/265 of 3rfxA
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
31% identity, 58% coverage: 13:170/273 of query aligns to 2:158/321 of 4id9A
- active site: S106 (= S119), Y132 (= Y144), K136 (= K148)
- binding nicotinamide-adenine-dinucleotide: G9 (= G20), R10 (≠ G21), V11 (≠ L22), D30 (= D41), L31 (≠ M45), R32 (≠ A46), S44 (≠ D59), L45 (= L60), L64 (≠ F79), A66 (≠ G81), V81 (≠ A94), S106 (= S119), Y132 (= Y144), K136 (= K148)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
31% identity, 58% coverage: 13:171/273 of query aligns to 3:160/328 of 4id9B
- active site: S107 (= S119), Y133 (= Y144), K137 (= K148)
- binding nicotinamide-adenine-dinucleotide: G10 (= G20), R11 (≠ G21), V12 (≠ L22), D31 (= D41), L32 (≠ M45), S45 (≠ D59), L46 (= L60), L65 (≠ F79), A67 (≠ G81), V82 (≠ A94), Y133 (= Y144), K137 (= K148), F160 (≠ I171)
Sites not aligning to the query:
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
26% identity, 58% coverage: 13:170/273 of query aligns to 2:163/311 of 3a4vA
- active site: T112 (≠ S119), Y137 (= Y144), K141 (= K148)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A19), G9 (= G20), Q10 (≠ G21), I11 (≠ L22), D32 (= D41), I33 (= I42), L46 (≠ C58), D47 (= D59), V48 (≠ L60), L69 (≠ F79), A70 (≠ G80), G71 (= G81), L73 (vs. gap), P110 (≠ A117), S111 (= S118), T112 (≠ S119), Y137 (= Y144), K141 (= K148)
- binding pyruvic acid: S74 (vs. gap), Y137 (= Y144)
Sites not aligning to the query:
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
26% identity, 58% coverage: 13:170/273 of query aligns to 2:163/315 of 3a1nA
- active site: T112 (≠ S119), Y137 (= Y144), K141 (= K148)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A19), G9 (= G20), Q10 (≠ G21), I11 (≠ L22), D32 (= D41), I33 (= I42), L46 (≠ C58), D47 (= D59), L69 (≠ F79), A70 (≠ G80), G71 (= G81), L73 (vs. gap), S111 (= S118), Y137 (= Y144), K141 (= K148)
Sites not aligning to the query:
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
25% identity, 58% coverage: 13:170/273 of query aligns to 2:163/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A19), G9 (= G20), Q10 (≠ G21), I11 (≠ L22), D32 (= D41), I33 (= I42), L46 (≠ C58), D47 (= D59), V48 (≠ L60), L69 (≠ F79), A70 (≠ G80), G71 (= G81), L73 (vs. gap), P110 (≠ A117), S111 (= S118), T112 (≠ S119), F137 (≠ Y144), K141 (= K148)
- binding (3R)-3-hydroxy-L-norvaline: S74 (vs. gap), T112 (≠ S119), I113 (≠ N120), F137 (≠ Y144)
Sites not aligning to the query:
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
25% identity, 58% coverage: 13:170/273 of query aligns to 2:163/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A19), G9 (= G20), Q10 (≠ G21), I11 (≠ L22), D32 (= D41), I33 (= I42), L46 (≠ C58), D47 (= D59), V48 (≠ L60), L69 (≠ F79), A70 (≠ G80), L73 (vs. gap), V87 (≠ A94), P110 (≠ A117), S111 (= S118), K141 (= K148)
- binding threonine: S74 (vs. gap), T112 (≠ S119), F137 (≠ Y144)
Sites not aligning to the query:
6jygD Crystal structure of l-threonine dehydrogenase from phytophthora infestans (see paper)
30% identity, 59% coverage: 11:170/273 of query aligns to 1:162/307 of 6jygD
- binding citrate anion: Q11 (≠ G21), L73 (≠ S83), S74 (≠ V84), Y136 (= Y144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G17), T9 (≠ A19), G10 (= G20), Q11 (≠ G21), I12 (≠ L22), D33 (vs. gap), I34 (vs. gap), K35 (≠ M45), D47 (= D59), V48 (≠ L60), M69 (≠ F79), A70 (≠ G80), S71 (≠ G81), L73 (≠ S83), V87 (≠ A94), P109 (≠ A117), S110 (= S118), T111 (≠ S119), Y136 (= Y144), K140 (= K148)
Sites not aligning to the query:
7cgvA Full consensus l-threonine 3-dehydrogenase, fctdh-iiym (NAD+ bound form) (see paper)
28% identity, 59% coverage: 11:170/273 of query aligns to 1:165/310 of 7cgvA
- binding nicotinamide-adenine-dinucleotide: G7 (= G17), G10 (= G20), Q11 (≠ G21), I12 (≠ L22), D33 (= D41), I34 (= I42), R35 (≠ M45), L48 (≠ C58), D49 (= D59), V50 (≠ L60), A72 (≠ G80), A73 (≠ G81), L75 (vs. gap), P112 (≠ A117), S114 (= S119), Y139 (= Y144), K143 (= K148)
Sites not aligning to the query:
3aw9A Structure of udp-galactose 4-epimerase mutant
29% identity, 58% coverage: 12:170/273 of query aligns to 2:157/304 of 3aw9A
- active site: A105 (= A117), S107 (= S119), S108 (≠ N120), T109 (≠ H121), Y131 (= Y144), K135 (= K148)
- binding galactose-uridine-5'-diphosphate: P69 (≠ S83), V71 (≠ E85), S107 (= S119), Y131 (= Y144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G17), G10 (= G20), F11 (≠ G21), I12 (≠ L22), D31 (= D41), I32 (= I42), R46 (≠ C58), D47 (= D59), L48 (= L60), F65 (= F79), A66 (≠ G80), A67 (≠ G81), E82 (≠ A94), A105 (= A117), S106 (= S118), Y131 (= Y144), K135 (= K148)
Sites not aligning to the query:
- active site: 166, 169
- binding galactose-uridine-5'-diphosphate: 160, 168, 170, 173, 188, 193, 195, 197, 234, 263, 266
- binding nicotinamide-adenine-dinucleotide: 158, 160, 161, 168
2c59A Gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), with gdp-alpha- d-mannose and gdp-beta-l-galactose bound in the active site. (see paper)
28% identity, 59% coverage: 12:172/273 of query aligns to 18:188/364 of 2c59A
- active site: S132 (= S119), A133 (≠ N120), C134 (≠ H121), Y163 (= Y144), K167 (= K148)
- binding guanosine-5'-diphosphate-beta-l-galactose: M91 (vs. gap), G92 (= G80), G93 (= G81), M94 (≠ V82), S132 (= S119), C134 (≠ H121)
- binding guanosine-5'-diphosphate-alpha-d-mannose: G92 (= G80), M94 (≠ V82), I97 (≠ V84), S132 (= S119), C134 (≠ H121), Y163 (= Y144)
- binding nicotinamide-adenine-dinucleotide: G23 (= G17), G26 (= G20), F27 (≠ G21), I28 (≠ L22), D47 (= D41), W48 (≠ I42), K49 (≠ A43), D67 (= D59), L68 (= L60), L87 (≠ F79), A89 (vs. gap), M91 (vs. gap), I111 (≠ G98), A130 (= A117), S132 (= S119), Y163 (= Y144), K167 (= K148)
Sites not aligning to the query:
- active site: 206
- binding guanosine-5'-diphosphate-beta-l-galactose: 191, 192, 206, 207, 210, 211, 214, 225, 230, 232, 266, 289, 290, 345
- binding guanosine-5'-diphosphate-alpha-d-mannose: 192, 206, 207, 210, 211, 214, 225, 230, 232, 266, 289, 290, 295, 345
- binding nicotinamide-adenine-dinucleotide: 190, 192, 193, 206
Q93VR3 GDP-mannose 3,5-epimerase; GDP-Man 3,5-epimerase; EC 5.1.3.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 59% coverage: 12:172/273 of query aligns to 29:199/377 of Q93VR3
- 34:60 (vs. 17:43, 30% identical) binding
- D58 (= D41) binding
- D78 (= D59) binding
- C145 (≠ H121) mutation to A: Loss of activity.; mutation to S: Strong reduction of activity.
- Y174 (= Y144) binding ; mutation to F: Loss of activity.
- K178 (= K148) binding ; mutation to R: Strong reduction of activity.
Sites not aligning to the query:
- 217 K→A: Loss of activity.
- 306 R→A: Strong reduction of activity.
2c54A Gdp-mannose-3', 5' -epimerase (arabidopsis thaliana),k178r, with gdp- beta-l-gulose and gdp-4-keto-beta-l-gulose bound in active site. (see paper)
28% identity, 59% coverage: 12:172/273 of query aligns to 17:187/362 of 2c54A
- active site: S131 (= S119), A132 (≠ N120), C133 (≠ H121), Y162 (= Y144), R166 (≠ K148)
- binding guanosine 5'-diphosphate-4-keto-beta-l-gulose: G91 (= G80), G92 (= G81), M93 (≠ V82), S131 (= S119)
- binding guanosine 5'-diphosphate-beta-l-gulose: G91 (= G80), G92 (= G81), M93 (≠ V82), S131 (= S119), C133 (≠ H121), Y162 (= Y144)
- binding nicotinamide-adenine-dinucleotide: G22 (= G17), G25 (= G20), F26 (≠ G21), I27 (≠ L22), D46 (= D41), W47 (≠ I42), K48 (≠ A43), V65 (≠ C58), D66 (= D59), L67 (= L60), L86 (≠ F79), A88 (vs. gap), M90 (vs. gap), I110 (≠ G98), A129 (= A117), S131 (= S119), Y162 (= Y144), R166 (≠ K148)
Sites not aligning to the query:
- active site: 205
- binding guanosine 5'-diphosphate-4-keto-beta-l-gulose: 190, 191, 205, 206, 209, 210, 213, 224, 229, 231, 265, 288, 289, 344
- binding guanosine 5'-diphosphate-beta-l-gulose: 190, 191, 205, 206, 209, 210, 213, 224, 229, 231, 265, 288, 289, 344
- binding nicotinamide-adenine-dinucleotide: 189, 191, 192, 205
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
27% identity, 60% coverage: 12:175/273 of query aligns to 3:181/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G17), G11 (= G20), F12 (≠ G21), I13 (≠ L22), D32 (≠ A43), N33 (= N44), N35 (≠ A46), Y38 (≠ I49), K43 (≠ E54), D61 (= D59), L62 (= L60), L83 (≠ F79), A84 (≠ G80), A85 (vs. gap), A123 (= A117), Y150 (= Y144), K154 (= K148), F177 (≠ I171), V180 (≠ S174)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
28% identity, 62% coverage: 12:180/273 of query aligns to 2:179/307 of 6wjaA
- active site: A118 (≠ S119), A119 (≠ N120), A120 (≠ H121), F143 (≠ Y144), K147 (= K148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G17), G10 (= G20), F11 (≠ G21), I12 (≠ L22), D31 (= D41), D32 (vs. gap), S34 (vs. gap), T35 (vs. gap), G36 (vs. gap), A55 (≠ L60), L74 (≠ F79), A75 (≠ G80), A76 (≠ G81), S93 (≠ A94), F143 (≠ Y144), K147 (= K148), F170 (≠ I171), F171 (≠ G172), I173 (≠ S174)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V84), A120 (≠ H121), N172 (≠ S173)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
28% identity, 62% coverage: 12:180/273 of query aligns to 3:180/308 of 6wj9B
- active site: A119 (≠ S119), A120 (≠ N120), A121 (≠ H121), F144 (≠ Y144), K148 (= K148)
- binding nicotinamide-adenine-dinucleotide: G8 (= G17), G11 (= G20), F12 (≠ G21), I13 (≠ L22), D32 (= D41), D33 (vs. gap), S35 (vs. gap), T36 (vs. gap), G37 (vs. gap), D55 (= D59), A56 (≠ L60), L75 (≠ F79), A76 (≠ G80), A77 (≠ G81), S94 (≠ A94), A117 (= A117), A119 (≠ S119), F144 (≠ Y144), K148 (= K148), F171 (≠ I171), F172 (≠ G172), I174 (≠ S174)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V84), N173 (≠ S173)
Sites not aligning to the query:
5z75A Artificial l-threonine 3-dehydrogenase designed by ancestral sequence reconstruction. (see paper)
25% identity, 58% coverage: 12:170/273 of query aligns to 4:166/306 of 5z75A
- binding nicotinamide-adenine-dinucleotide: G9 (= G17), C11 (≠ A19), G12 (= G20), Q13 (≠ G21), I14 (≠ L22), D35 (= D41), I36 (= I42), L49 (≠ C58), V51 (≠ L60), L72 (≠ F79), A73 (≠ G80), L76 (≠ S83), P113 (≠ A117), S115 (= S119), Y140 (= Y144), K144 (= K148)
Sites not aligning to the query:
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
30% identity, 60% coverage: 12:175/273 of query aligns to 2:182/322 of 1r6dA
- active site: T127 (≠ S119), N128 (= N120), Q129 (≠ H121), Y151 (= Y144), K155 (= K148)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S83), H88 (vs. gap), T127 (≠ S119), N128 (= N120), Q129 (≠ H121), Y151 (= Y144), N180 (≠ S173)
- binding nicotinamide-adenine-dinucleotide: G10 (= G20), F11 (≠ G21), I12 (≠ L22), D37 (≠ S40), S38 (≠ D41), L39 (≠ I42), T40 (vs. gap), A42 (vs. gap), G43 (vs. gap), D63 (= D59), I64 (≠ L60), F83 (= F79), A84 (≠ G80), A85 (≠ G81), S87 (= S83), T102 (vs. gap), V125 (≠ A117), S126 (= S118), Y151 (= Y144), K155 (= K148), N181 (≠ S174)
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_489 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_489
MTTTQIRHPFNRLLLTGAAGGLGKVLRERLKPFARHIRLSDIANMAPAIDESEEVMPCDL
SDKQAVHQLVEGVDAILHFGGVSVERPFEEILGANISGVFHIYEAARKHGVKRVIFASSN
HVIGFYKQDETIDALSPRRPDGYYGLSKSYGEDVASFYFDRYGIETVSIRIGSSFPEPQN
RRMMSTWLSFDDLTQLIECSLYTPKVGHTVVYGMSANRDVWWDNSHAAHLGYQPKDTSEI
FRAKVEAQPMPAADDPAMVYQGGAFVAAGPFDD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory