Comparing Pf6N2E2_5103 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5103 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
44% identity, 98% coverage: 8:370/372 of query aligns to 2:363/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
44% identity, 98% coverage: 5:370/372 of query aligns to 1:365/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 98% coverage: 8:370/372 of query aligns to 2:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 98% coverage: 8:370/372 of query aligns to 2:321/323 of 2j5vA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
34% identity, 70% coverage: 2:260/372 of query aligns to 6:257/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
33% identity, 70% coverage: 2:260/372 of query aligns to 6:235/236 of 7f5xA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
33% identity, 62% coverage: 9:240/372 of query aligns to 1:219/241 of 2akoA
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
36% identity, 36% coverage: 129:261/372 of query aligns to 103:225/225 of Q8U122
Sites not aligning to the query:
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
36% identity, 36% coverage: 129:261/372 of query aligns to 104:226/226 of 2bmuB
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
33% identity, 36% coverage: 129:261/372 of query aligns to 105:219/219 of 2ji5A
Sites not aligning to the query:
8u0mA Isopentenyl phosphate kinase (see paper)
25% identity, 53% coverage: 62:259/372 of query aligns to 67:243/247 of 8u0mA
Sites not aligning to the query:
8u0nA Isopentenyl phosphate kinase (see paper)
24% identity, 53% coverage: 62:259/372 of query aligns to 66:241/245 of 8u0nA
Sites not aligning to the query:
8u0mB Isopentenyl phosphate kinase (see paper)
24% identity, 53% coverage: 62:259/372 of query aligns to 68:243/247 of 8u0mB
Sites not aligning to the query:
8u0lA Isopentenyl phosphate kinase (see paper)
24% identity, 53% coverage: 62:259/372 of query aligns to 68:243/247 of 8u0lA
Sites not aligning to the query:
8u0kA Isopentenyl phosphate kinase (see paper)
24% identity, 53% coverage: 62:259/372 of query aligns to 68:243/247 of 8u0kA
Sites not aligning to the query:
3ll5A Crystal structure of t. Acidophilum isopentenyl phosphate kinase product complex (see paper)
35% identity, 19% coverage: 123:192/372 of query aligns to 113:183/233 of 3ll5A
Sites not aligning to the query:
3lkkB Crystal structure of the isopentenyl phosphate kinase substrate complex (see paper)
35% identity, 19% coverage: 123:192/372 of query aligns to 114:184/238 of 3lkkB
Sites not aligning to the query:
>Pf6N2E2_5103 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5103
MRSKVTGAQRWVVKIGSALLTADGKGLDRQAMAVWVEQMVALHEAGVELVLVSSGAVAAG
MSRLGWTSRPSAMHELQAAAAIGQMGLVQAWESSFAEHGRHTAQILLTHDDLSDRKRYLN
ARSTLRALVELKVIPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPDAKLIYEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIVGG
RLERVLDRLKAGERIGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVVALSQGNKSL
LPVGVKLVQGSFRRGEMVVCVAPDGREIARGLANYSALEAQKIIGQSSDAIVGLLGYMAE
PELVHRDNLILV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory