Comparing Pf6N2E2_5166 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5166 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 97% coverage: 5:251/255 of query aligns to 15:261/265 of P07821
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
38% identity, 83% coverage: 27:237/255 of query aligns to 25:231/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
36% identity, 89% coverage: 27:254/255 of query aligns to 25:246/248 of 4fi3C
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 92% coverage: 1:235/255 of query aligns to 2:233/240 of 6mjpA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 85% coverage: 1:218/255 of query aligns to 4:230/254 of 1g6hA
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 85% coverage: 1:217/255 of query aligns to 84:315/345 of Q9AT00
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 96% coverage: 1:246/255 of query aligns to 1:251/343 of P30750
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 91% coverage: 12:244/255 of query aligns to 16:254/280 of 5x40A
Sites not aligning to the query:
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
33% identity, 85% coverage: 12:228/255 of query aligns to 330:542/865 of O65934
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 96% coverage: 1:246/255 of query aligns to 2:252/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 96% coverage: 1:246/255 of query aligns to 2:252/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 96% coverage: 1:246/255 of query aligns to 2:252/344 of 3tuiC
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
31% identity, 85% coverage: 5:222/255 of query aligns to 7:224/262 of 7chaI
7arlD Lolcde in complex with lipoprotein and adp (see paper)
35% identity, 80% coverage: 16:218/255 of query aligns to 21:222/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
35% identity, 80% coverage: 16:218/255 of query aligns to 24:225/233 of P75957
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
31% identity, 92% coverage: 2:235/255 of query aligns to 3:233/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
31% identity, 92% coverage: 2:235/255 of query aligns to 3:233/234 of 4p31A
7mdyC Lolcde nucleotide-bound
35% identity, 80% coverage: 16:218/255 of query aligns to 21:222/226 of 7mdyC
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
31% identity, 92% coverage: 2:235/255 of query aligns to 3:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
31% identity, 92% coverage: 2:235/255 of query aligns to 3:233/238 of 6s8gA
>Pf6N2E2_5166 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5166
MLRAQNLHIQRGRKTVLADVDLALNPGEVLGVLGPNGAGKSTLLAGLCGELRPAQGQVWL
DDRPLAQWQGAERARRLAVLPQSSTLDFAFRVEEVVGMGRLPHQSGRVRDEQIVASALQV
ADAAHLHGRSYLALSGGERQRVHLARVLVQLWPGETGQTLLLDEPTSMLDPLHQHTILQA
VREFASRGAAVLVILHDLNLAARYCDRLLLLASGRPVALDTPRHVLRPEPLKAVFGLEVL
VQDHPERGHPLIIAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory