SitesBLAST
Comparing Pf6N2E2_5206 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5206 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
50% identity, 98% coverage: 2:243/247 of query aligns to 4:245/249 of 4bmsF
- active site: S137 (= S135), H147 (≠ R145), Y150 (≠ L148), K154 (= K152), Q195 (≠ E193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), N15 (= N13), S16 (= S14), I18 (= I16), R38 (= R36), R39 (≠ D37), A59 (= A57), D60 (= D58), V61 (= V59), N87 (= N85), S88 (≠ A86), G89 (= G87), V110 (≠ I108), S137 (= S135), Y150 (≠ L148), K154 (= K152), G181 (= G179), I183 (= I181), T185 (= T183), I187 (= I185)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
50% identity, 98% coverage: 2:243/247 of query aligns to 4:245/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S135), H147 (≠ R145), Y150 (≠ L148), L188 (≠ H186)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), N15 (= N13), S16 (= S14), G17 (= G15), I18 (= I16), R38 (= R36), R39 (≠ D37), D60 (= D58), V61 (= V59), N87 (= N85), S88 (≠ A86), G89 (= G87), V110 (≠ I108), T135 (≠ S133), S137 (= S135), Y150 (≠ L148), K154 (= K152), P180 (= P178), G181 (= G179), A182 (= A180), I183 (= I181), T185 (= T183), S187 (≠ I185)
Sites not aligning to the query:
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
42% identity, 97% coverage: 4:243/247 of query aligns to 5:243/251 of 4esoB
- active site: G16 (= G15), S136 (= S135), M146 (≠ R145), Y149 (≠ L148), K153 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), T14 (≠ N13), H15 (≠ S14), M17 (≠ I16), R37 (= R36), N38 (≠ D37), N41 (≠ K40), S58 (≠ A57), D59 (= D58), I60 (≠ V59), N86 (= N85), A87 (= A86), G88 (= G87), T134 (≠ S133), S136 (= S135), Y149 (≠ L148), P179 (= P178), G180 (= G179), I182 (= I181), T184 (= T183), T186 (≠ I185), K187 (≠ H186), G188 (≠ H187)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 98% coverage: 2:243/247 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G15), N111 (= N109), S139 (= S135), Q149 (≠ R145), Y152 (≠ L148), K156 (= K152)
- binding acetoacetyl-coenzyme a: D93 (≠ G91), K98 (≠ S96), S139 (= S135), N146 (≠ A142), V147 (≠ P143), Q149 (≠ R145), Y152 (≠ L148), F184 (≠ A180), M189 (≠ I185), K200 (≠ R202)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G11), N17 (≠ S14), G18 (= G15), I19 (= I16), D38 (= D39), F39 (≠ K40), V59 (≠ A57), D60 (= D58), V61 (= V59), N87 (= N85), A88 (= A86), G89 (= G87), I90 (≠ V88), T137 (≠ S133), S139 (= S135), Y152 (≠ L148), K156 (= K152), P182 (= P178), F184 (≠ A180), T185 (≠ I181), T187 (= T183), M189 (≠ I185)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
37% identity, 98% coverage: 2:243/247 of query aligns to 4:247/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S135), I143 (≠ W136), Y155 (≠ L148), F205 (≠ Y199)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (≠ N13), L16 (≠ S14), G17 (= G15), I18 (= I16), R38 (= R36), H39 (≠ D37), D62 (= D58), A63 (≠ V59), N89 (= N85), A90 (= A86), V112 (≠ I108), M140 (≠ S133), S142 (= S135), Y155 (≠ L148), K159 (= K152), P187 (= P178), P189 (≠ A180), I190 (= I181), T192 (= T183), P193 (= P184), L194 (≠ I185)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
37% identity, 98% coverage: 2:243/247 of query aligns to 6:249/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S135), I145 (≠ W136), E146 (≠ L137), Y157 (≠ L148), V197 (≠ H186), F207 (≠ Y199)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G11), T17 (≠ N13), I20 (= I16), R40 (= R36), H41 (≠ D37), D64 (= D58), A65 (≠ V59), N91 (= N85), A92 (= A86), V114 (≠ I108), M142 (≠ S133), S144 (= S135), Y157 (≠ L148), K161 (= K152), P189 (= P178), G190 (= G179), P191 (≠ A180), I192 (= I181), T194 (= T183), P195 (= P184), L196 (≠ I185)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
36% identity, 98% coverage: 1:243/247 of query aligns to 2:240/244 of 7krmC
- active site: G18 (= G15), S140 (= S135), Y155 (≠ L148)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), S15 (= S14), G18 (= G15), I19 (= I16), D38 (≠ G35), L39 (≠ R36), A60 (= A57), N61 (≠ D58), V62 (= V59), N88 (= N85), V111 (≠ I108), S140 (= S135), Y155 (≠ L148), K159 (= K152), I188 (= I181), T190 (= T183)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
37% identity, 98% coverage: 2:243/247 of query aligns to 5:248/252 of Q6WVP7
Sites not aligning to the query:
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
37% identity, 98% coverage: 2:244/247 of query aligns to 8:251/262 of 3pk0B
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 98% coverage: 2:243/247 of query aligns to 5:251/255 of 5itvA
- active site: G18 (= G15), S141 (= S135), Y154 (≠ L148), K158 (= K152)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G11), S17 (= S14), G18 (= G15), I19 (= I16), D38 (≠ G35), I39 (≠ R36), T61 (≠ A57), I63 (≠ V59), N89 (= N85), G91 (= G87), T139 (≠ S133), S141 (= S135), Y154 (≠ L148), K158 (= K152), P184 (= P178), G185 (= G179), I186 (≠ A180), I187 (= I181)
A7DY56 Tropinone reductase; EC 1.1.1.206; EC 1.1.1.236 from Cochlearia officinalis (Common scurvygrass) (see paper)
36% identity, 98% coverage: 2:243/247 of query aligns to 16:259/273 of A7DY56
- Y209 (≠ P189) mutation to S: Loss of tropinone or nortropinone reduction, but faster reduction of cyclohexanones.
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
37% identity, 98% coverage: 2:243/247 of query aligns to 4:237/241 of 5t2uA
- active site: G17 (= G15), T135 (≠ S135), T145 (≠ R145), Y148 (≠ L148), K152 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), G17 (= G15), R38 (= R36), D39 (= D37), R42 (≠ K40), D60 (= D58), L61 (≠ V59), N83 (= N85), A84 (= A86), Y87 (≠ T92), I133 (≠ S133), T135 (≠ S135), Y148 (≠ L148), K152 (= K152), P178 (= P178), P180 (≠ A180), T181 (≠ I181), T183 (= T183), T185 (≠ I185), T186 (≠ S192)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
35% identity, 98% coverage: 2:243/247 of query aligns to 9:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G11), S20 (≠ N13), K21 (≠ S14), G22 (= G15), I23 (= I16), A43 (vs. gap), S44 (vs. gap), S45 (≠ T34), G68 (≠ A57), D69 (= D58), V70 (= V59), N96 (= N85), S97 (≠ A86), G98 (= G87), Y100 (≠ A89), I144 (≠ S133), S146 (= S135), Y159 (≠ L148), K163 (= K152), P189 (= P178), G190 (= G179), M191 (≠ A180), I192 (= I181), T194 (= T183), G196 (≠ I185), T197 (≠ H186)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S135), Y159 (≠ L148), M191 (≠ A180), I202 (≠ Q191)
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
36% identity, 98% coverage: 2:243/247 of query aligns to 4:247/251 of 1zk4A
- active site: G17 (= G15), S142 (= S135), Y155 (≠ L148), K159 (= K152)
- binding 1-phenylethanone: A93 (= A89), Y155 (≠ L148), Y189 (≠ A180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (≠ N13), L16 (≠ S14), I18 (= I16), T36 (= T34), G37 (= G35), R38 (= R36), H61 (≠ D58), D62 (≠ V59), N89 (= N85), A90 (= A86), G91 (= G87), I92 (≠ V88), Y155 (≠ L148), G188 (= G179), I190 (= I181), T192 (= T183), L194 (≠ I185)
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
34% identity, 98% coverage: 2:244/247 of query aligns to 9:253/257 of 5fffA
- active site: K206 (≠ R197)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (≠ A89), H158 (≠ R145)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G11), T20 (≠ N13), G22 (= G15), I23 (= I16), R43 (= R36), C67 (≠ A57), D68 (= D58), V69 (= V59), N96 (= N85), I146 (≠ S133), Y161 (≠ L148), K165 (= K152), P191 (= P178), A193 (= A180), I194 (= I181), T196 (= T183), G198 (≠ P189), T199 (≠ N190)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
34% identity, 98% coverage: 2:244/247 of query aligns to 9:253/257 of 5ff9B
- active site: K206 (≠ R197)
- binding 4-(2-aminoethyl)phenol: Y100 (≠ A89), I155 (≠ A142), H158 (≠ R145)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G11), T20 (≠ N13), K21 (≠ S14), I23 (= I16), S42 (≠ G35), R43 (= R36), C67 (≠ A57), D68 (= D58), V69 (= V59), N96 (= N85), I146 (≠ S133), S148 (= S135), Y161 (≠ L148), K165 (= K152), P191 (= P178), A193 (= A180), I194 (= I181), T196 (= T183), G198 (≠ P189), T199 (≠ N190)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
34% identity, 98% coverage: 2:244/247 of query aligns to 9:253/257 of A0A1A9TAK5
6y0sAAA R-specific alcohol dehydrogenase (see paper)
36% identity, 98% coverage: 2:243/247 of query aligns to 4:247/251 of 6y0sAAA
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
36% identity, 98% coverage: 2:243/247 of query aligns to 6:244/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G11), R18 (≠ S14), G19 (= G15), I20 (= I16), D39 (≠ G35), R40 (= R36), C63 (≠ A57), I65 (≠ V59), N91 (= N85), G93 (= G87), I94 (≠ V88), V114 (≠ I108), Y155 (≠ L148), K159 (= K152), I188 (= I181), T190 (= T183), T193 (≠ H186)
2hsdA The refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases (see paper)
36% identity, 98% coverage: 2:243/247 of query aligns to 3:240/253 of 2hsdA
- active site: G16 (= G15), S138 (= S135), Y151 (≠ L148), K155 (= K152)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), R15 (≠ S14), G16 (= G15), L17 (≠ I16), D36 (≠ G35), V37 (≠ R36), L58 (≠ A57), V60 (= V59), N86 (= N85), A87 (= A86), S138 (= S135), Y151 (≠ L148), K155 (= K152), P181 (= P178), G182 (= G179), T184 (≠ I181)
Query Sequence
>Pf6N2E2_5206 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5206
MLTGKTALITGGNSGIGLATAKVFLAHGARVAITGRDADKLAAARRELGPGVITLVADVS
SSEQLRQMAKVVEQEFGGLDIFFANAGVAFGTPLSSTTEEQYDRLMDINVKGVFFSVQAI
EPIMRPGGSIILSTSWLNQVGAPDRTLLSASKAAVRCFARTLSAELLERRIRVNAVSPGA
IETPIHHQPNQSEEEYRAYAERVGAQAPIGRMGRAEEVAAAVLFLASDASSYMLGAEVVV
DGGRAEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory