SitesBLAST
Comparing Pf6N2E2_5209 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5209 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
38% identity, 98% coverage: 1:253/257 of query aligns to 1:247/249 of 4bmsF
- active site: S137 (= S142), H147 (≠ S154), Y150 (= Y157), K154 (≠ N161), Q195 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ G15), S16 (= S16), I18 (= I18), R38 (= R38), R39 (≠ D39), A59 (≠ G62), D60 (= D63), V61 (≠ I64), N87 (= N90), S88 (≠ A91), G89 (= G92), V110 (≠ I113), S137 (= S142), Y150 (= Y157), K154 (≠ N161), G181 (≠ A188), I183 (≠ V190), T185 (= T192), I187 (≠ V194)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
36% identity, 96% coverage: 4:251/257 of query aligns to 3:242/248 of Q9KJF1
- S15 (= S16) binding
- D36 (≠ G37) binding
- D62 (= D63) binding
- I63 (= I64) binding
- N89 (= N90) binding
- Y153 (= Y157) binding
- K157 (≠ N161) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
36% identity, 96% coverage: 4:251/257 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), M16 (≠ I18), D35 (≠ G37), I36 (≠ R38), I62 (= I64), N88 (= N90), G90 (= G92), I138 (≠ T140), S140 (= S142), Y152 (= Y157), K156 (≠ N161), I185 (≠ V190)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
37% identity, 98% coverage: 1:253/257 of query aligns to 1:247/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S142), H147 (≠ S154), Y150 (= Y157), L188 (≠ V194), L246 (≠ V252)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ G15), S16 (= S16), G17 (= G17), I18 (= I18), R38 (= R38), R39 (≠ D39), D60 (= D63), V61 (≠ I64), N87 (= N90), S88 (≠ A91), G89 (= G92), V110 (≠ I113), T135 (= T140), S137 (= S142), Y150 (= Y157), K154 (≠ N161), P180 (= P187), G181 (≠ A188), A182 (≠ V189), I183 (≠ V190), T185 (= T192), S187 (vs. gap)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 98% coverage: 3:254/257 of query aligns to 4:254/255 of 5itvA
- active site: G18 (= G17), S141 (= S142), Y154 (= Y157), K158 (≠ N161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (= S16), G18 (= G17), I19 (= I18), D38 (≠ G37), I39 (≠ R38), T61 (≠ G62), I63 (= I64), N89 (= N90), G91 (= G92), T139 (= T140), S141 (= S142), Y154 (= Y157), K158 (≠ N161), P184 (= P187), G185 (≠ A188), I186 (≠ V189), I187 (≠ V190)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
35% identity, 98% coverage: 4:254/257 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G17), S142 (= S142), Y155 (= Y157), K159 (≠ N161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (= S16), G16 (= G17), I17 (= I18), D36 (≠ G37), I37 (≠ R38), A61 (≠ G62), D62 (= D63), T63 (≠ I64), N89 (= N90), A90 (= A91), M140 (≠ T140), S142 (= S142), Y155 (= Y157), K159 (≠ N161), P185 (= P187), A186 (= A188), Y187 (≠ V189), I188 (≠ V190), L192 (≠ V194)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
37% identity, 97% coverage: 4:252/257 of query aligns to 3:241/244 of 7krmC
- active site: G18 (= G17), S140 (= S142), Y155 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (= S16), G18 (= G17), I19 (= I18), D38 (≠ G37), L39 (≠ R38), A60 (≠ G62), N61 (≠ D63), V62 (≠ I64), N88 (= N90), V111 (≠ I113), S140 (= S142), Y155 (= Y157), K159 (≠ N161), I188 (≠ V190), T190 (= T192)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
35% identity, 97% coverage: 3:252/257 of query aligns to 2:241/244 of 6t77A
- active site: G16 (= G17), S138 (= S142), Y151 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ G15), R15 (≠ S16), T37 (≠ D39), L58 (≠ F59), N59 (≠ H60), V60 (≠ A61), A87 (= A91), G88 (= G92), I89 (= I93)
5ojiA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
38% identity, 98% coverage: 4:254/257 of query aligns to 8:258/260 of 5ojiA
- active site: G21 (= G17), S148 (= S142), Y161 (= Y157), K165 (≠ N161)
- binding isatin: S148 (= S142), S150 (≠ W144), Y161 (= Y157), V193 (= V189), S199 (≠ Y195), L202 (≠ F198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G13), T19 (≠ G15), I22 (= I18), S41 (≠ G37), R42 (= R38), N43 (≠ D39), N46 (≠ K42), I69 (= I64), N95 (= N90), H96 (≠ A91), G97 (= G92), N146 (≠ T140), S148 (= S142), Y161 (= Y157), K165 (≠ N161), G192 (≠ A188), I194 (≠ V190), T196 (= T192), M198 (≠ V194)
5ojgA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
38% identity, 98% coverage: 4:254/257 of query aligns to 8:258/260 of 5ojgA
- active site: G21 (= G17), S148 (= S142), Y161 (= Y157), K165 (≠ N161)
- binding butane-2,3-dione: S148 (= S142), Y161 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G13), T19 (≠ G15), G21 (= G17), I22 (= I18), S41 (≠ G37), R42 (= R38), N43 (≠ D39), N46 (≠ K42), I69 (= I64), N95 (= N90), H96 (≠ A91), G97 (= G92), N146 (≠ T140), S148 (= S142), Y161 (= Y157), K165 (≠ N161), P191 (= P187), I194 (≠ V190), T196 (= T192), M198 (≠ V194)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
38% identity, 95% coverage: 9:251/257 of query aligns to 9:237/241 of 5t2uA
- active site: G17 (= G17), T135 (≠ S142), T145 (= T152), Y148 (= Y157), K152 (≠ N161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), G17 (= G17), R38 (= R38), D39 (= D39), R42 (≠ K42), D60 (= D63), L61 (≠ I64), N83 (= N90), A84 (= A91), Y87 (≠ F94), I133 (≠ T140), T135 (≠ S142), Y148 (= Y157), K152 (≠ N161), P178 (= P187), P180 (≠ V189), T181 (≠ V190), T183 (= T192), T185 (≠ V194), T186 (≠ Y195)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 98% coverage: 1:252/257 of query aligns to 2:242/244 of 4nbuB
- active site: G18 (= G17), N111 (≠ I114), S139 (= S142), Q149 (≠ S154), Y152 (= Y157), K156 (≠ N161)
- binding acetoacetyl-coenzyme a: D93 (≠ P96), K98 (≠ E101), S139 (= S142), N146 (≠ A151), V147 (≠ T152), Q149 (≠ S154), Y152 (= Y157), F184 (≠ V189), M189 (= M199), K200 (≠ T210)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (= I18), D38 (vs. gap), F39 (vs. gap), V59 (≠ G62), D60 (= D63), V61 (≠ I64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (= I93), T137 (= T140), S139 (= S142), Y152 (= Y157), K156 (≠ N161), P182 (= P187), F184 (≠ V189), T185 (≠ V190), T187 (= T192), M189 (= M199)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
35% identity, 95% coverage: 8:252/257 of query aligns to 3:242/244 of 1edoA
- active site: G12 (= G17), S138 (= S142), Y151 (= Y157), K155 (≠ N161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ G15), R11 (≠ S16), I13 (= I18), N31 (≠ G36), Y32 (vs. gap), A33 (≠ G37), R34 (= R38), S35 (≠ D39), D59 (= D63), V60 (≠ I64), N86 (= N90), A87 (= A91), S138 (= S142), Y151 (= Y157), K155 (≠ N161), P181 (= P187), G182 (≠ A188), I184 (≠ V190), S186 (≠ T192), M188 (≠ V194)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
36% identity, 98% coverage: 4:254/257 of query aligns to 8:252/258 of 4wecA
- active site: G21 (= G17), S143 (= S142), Q154 (≠ S154), Y157 (= Y157), K161 (≠ N161)
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), A19 (≠ G15), S20 (= S16), G21 (= G17), I22 (= I18), D41 (≠ G37), I42 (≠ R38), V61 (≠ G62), D62 (= D63), V63 (≠ I64), N89 (= N90), T141 (= T140), Y157 (= Y157), K161 (≠ N161), P187 (= P187), P189 (≠ V189), V190 (= V190)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 97% coverage: 3:252/257 of query aligns to 2:241/244 of P0A2C9
- M125 (= M129) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A234) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S235) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 97% coverage: 3:252/257 of query aligns to 2:245/247 of 4jroC
- active site: G16 (= G17), S142 (= S142), Q152 (≠ S154), Y155 (= Y157), K159 (≠ N161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ G15), R15 (≠ S16), G16 (= G17), I17 (= I18), N35 (≠ G36), Y36 (≠ G37), N37 (≠ R38), G38 (≠ D39), S39 (≠ A40), N63 (≠ D63), V64 (≠ I64), N90 (= N90), A91 (= A91), I93 (= I93), I113 (= I113), S142 (= S142), Y155 (= Y157), K159 (≠ N161), P185 (= P187), I188 (≠ V190), T190 (= T192)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 97% coverage: 3:252/257 of query aligns to 5:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ G15), R18 (≠ S16), I20 (= I18), T40 (≠ D39), N62 (≠ D63), V63 (≠ I64), N89 (= N90), A90 (= A91), I92 (= I93), V139 (≠ T140), S141 (= S142), Y154 (= Y157), K158 (≠ N161), P184 (= P187), G185 (≠ A188), I187 (≠ V190), T189 (= T192), M191 (≠ V194)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
35% identity, 97% coverage: 3:252/257 of query aligns to 5:240/243 of 4i08A
- active site: G19 (= G17), N113 (≠ I114), S141 (= S142), Q151 (≠ S154), Y154 (= Y157), K158 (≠ N161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ G15), R18 (≠ S16), I20 (= I18), T40 (≠ D39), N62 (≠ D63), V63 (≠ I64), N89 (= N90), A90 (= A91), G140 (= G141), S141 (= S142), Y154 (= Y157), K158 (≠ N161), P184 (= P187), G185 (≠ A188), T189 (= T192)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
35% identity, 98% coverage: 1:252/257 of query aligns to 6:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (≠ G15), K21 (≠ S16), G22 (= G17), I23 (= I18), A43 (vs. gap), S44 (vs. gap), S45 (vs. gap), G68 (= G62), D69 (= D63), V70 (≠ I64), N96 (= N90), S97 (≠ A91), G98 (= G92), Y100 (≠ F94), I144 (≠ T140), S146 (= S142), Y159 (= Y157), K163 (≠ N161), P189 (= P187), G190 (≠ A188), M191 (≠ V189), I192 (≠ V190), T194 (= T192), G196 (vs. gap), T197 (vs. gap)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S142), Y159 (= Y157), M191 (≠ V189), I202 (≠ V194)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
36% identity, 98% coverage: 4:254/257 of query aligns to 3:250/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G16 (= G17), I17 (= I18), D36 (≠ G37), L37 (≠ R38), C61 (≠ G62), D62 (= D63), V63 (≠ I64), N89 (= N90), A90 (= A91), T140 (= T140), S142 (= S142), Y155 (= Y157), K159 (≠ N161), A186 (= A188), V187 (= V189)
Query Sequence
>Pf6N2E2_5209 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5209
MNSFSNKIAIVTGGGSGIGKEVTKRLVEAGASVVIGGRDAVKLAQVAQEIDASGQKVRFH
AGDIAKPATAQALVDLAASSFGGVDILINNAGIFNPKPFLEVSPEEYDAFLDIILKGKFF
MAQAAAKAMLKRGGGAIVQTGSLWAIQAIGATPSAAYSAANAGVHALTRNLALELAGSNI
RINTVAPAVVETPVYGTFMDADQVKEVLPTFNAFHPLGRNGQPADVAQAMLFLASDEASW
ITGTVLPVDGGVTAGRN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory