SitesBLAST
Comparing Pf6N2E2_5239 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5239 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q55415 Bicarbonate transporter BicA from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
28% identity, 91% coverage: 22:547/580 of query aligns to 9:524/564 of Q55415
- T69 (= T82) binding ; mutation to A: Alters bicarbonate transport.
- D258 (≠ E290) binding ; mutation D->A,E: Alters bicarbonate transport.
- T262 (≠ C294) binding ; mutation to A: Alters bicarbonate transport.
- G300 (≠ A332) binding
- A301 (= A333) binding
- T302 (≠ I334) binding ; mutation to A: Alters bicarbonate transport.
- A471 (≠ V494) mutation to N: Alters bicarbonate transport.
- L476 (≠ M499) mutation to S: Alters bicarbonate transport.
- A486 (= A509) mutation to E: Alters bicarbonate transport.
- L490 (≠ F513) mutation to Q: Alters bicarbonate transport.
5da0A Structure of the the slc26 transporter slc26dg in complex with a nanobody (see paper)
27% identity, 86% coverage: 26:524/580 of query aligns to 9:448/467 of 5da0A
Sites not aligning to the query:
7lhvA Structure of arabidopsis thaliana sulfate transporter atsultr4;1 (see paper)
26% identity, 92% coverage: 12:545/580 of query aligns to 16:553/575 of 7lhvA
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: L126 (≠ M118), R127 (= R119), W130 (≠ R122)
- binding (2S,3R,4E)-2-amino-3-hydroxyoctadec-4-en-1-yl dihydrogen phosphate: L128 (≠ A120), L131 (= L123), E409 (≠ V422), L413 (≠ A426), G417 (≠ L430), A421 (≠ G434)
- binding sulfate ion: A84 (= A83), S321 (≠ A333), F322 (≠ I334)
6ki1B The transmembrane domain of a cyanobacterium bicarbonate transporter bica (see paper)
30% identity, 70% coverage: 22:425/580 of query aligns to 8:391/392 of 6ki1B
7v74A Thermostabilized human prestin in complex with sulfate (see paper)
28% identity, 92% coverage: 16:548/580 of query aligns to 13:570/597 of 7v74A
7v75A Thermostabilized human prestin in complex with salicylate (see paper)
28% identity, 92% coverage: 16:548/580 of query aligns to 13:578/605 of 7v75A
Q9URY8 Probable sulfate permease C869.05c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 63% coverage: 16:382/580 of query aligns to 112:480/840 of Q9URY8
Sites not aligning to the query:
- 823 modified: Phosphoserine
Q9BXS9 Solute carrier family 26 member 6; Anion exchange transporter; Pendrin-like protein 1; Pendrin-L1 from Homo sapiens (Human) (see 3 papers)
25% identity, 78% coverage: 35:487/580 of query aligns to 100:563/759 of Q9BXS9
- N167 (≠ G99) modified: carbohydrate, N-linked (GlcNAc) asparagine; mutation to Q: Reduced chloride oxalate exchanger activity.
- N172 (≠ C104) modified: carbohydrate, N-linked (GlcNAc) asparagine; mutation to Q: Reduced chloride oxalate exchanger activity.
- V206 (≠ L123) to M: in dbSNP:rs13324142
- ATV 547:549 (≠ -PL 472:473) mutation to NVN: Does not inhibit cell membrane localization. Inhibits interaction with CA2 and bicarbonate transport.
- N553 (≠ A477) mutation to A: Does not inhibit interaction with CA2. Inhibits interaction with CA2 and bicarbonate transport in PMA-induced cells.
Sites not aligning to the query:
- 582 S→A: Does not inhibit interaction with CA2. Does not inhibit interaction with CA2 and bicarbonate transport in PMA-induced cells.
Q8CIW6 Solute carrier family 26 member 6; Anion exchange transporter; Chloride-formate exchanger; Pendrin-L1; Pendrin-like protein 1; Putative anion transporter-1; Pat-1 from Mus musculus (Mouse) (see paper)
24% identity, 78% coverage: 35:487/580 of query aligns to 102:564/758 of Q8CIW6
- F552 (= F475) mutation to A: Does not inhibit formate transport in PMA-induced cells.
7xujA Human slc26a3 in complex with uk5099
23% identity, 81% coverage: 10:476/580 of query aligns to 54:525/703 of 7xujA
- binding (E)-2-cyano-3-(1-phenylindol-3-yl)prop-2-enoic acid: V79 (≠ I38), Q83 (≠ L42), E271 (≠ L209), S376 (≠ A335), R377 (= R336), V380 (≠ T339), L421 (= L380), A422 (vs. gap), N425 (vs. gap)
- binding cholesterol hemisuccinate: F171 (≠ L115), V311 (≠ Y270), Q315 (≠ R274)
7xulA Human slc26a3 in complex with tenidap
23% identity, 81% coverage: 10:476/580 of query aligns to 47:516/690 of 7xulA
- binding 5-chloranyl-2-oxidanyl-3-thiophen-2-ylcarbonyl-indole-1-carboxamide: V72 (≠ I38), L75 (≠ P41), Q76 (≠ L42), E262 (≠ L209), S367 (≠ A335), L412 (= L380), N416 (vs. gap)
- binding cholesterol hemisuccinate: I157 (≠ L110), F162 (≠ L115), P209 (vs. gap), K214 (≠ E165), Y217 (≠ G168), V302 (≠ Y270), Q306 (≠ R274), V309 (≠ L277), V450 (= V422)
7xuhA Down-regulated in adenoma in complex with tqr1122
23% identity, 81% coverage: 10:476/580 of query aligns to 54:529/707 of 7xuhA
- binding 2-[4,8-dimethyl-2-oxidanylidene-7-[[3-(trifluoromethyl)phenyl]methoxy]chromen-3-yl]ethanoic acid: P124 (vs. gap), I125 (vs. gap), L187 (≠ I127), I192 (= I132), F195 (= F135), V335 (≠ E290), S338 (≠ L293), S380 (≠ A335), M433 (≠ V384)
- binding cholesterol hemisuccinate: V223 (vs. gap), F226 (≠ I164), K227 (≠ E165), Y230 (≠ G168), F318 (≠ I273), Q319 (≠ R274)
A0FKN5 Prestin; Solute carrier family 26 member 5 from Gallus gallus (Chicken) (see paper)
24% identity, 70% coverage: 23:430/580 of query aligns to 79:503/742 of A0FKN5
- S404 (≠ A335) Controls the anion transport; mutation to A: Alters anion selectivity.; mutation to C: Abolishes sulfate transport. Does not affect oxalate transport. Is accesible both from extracellular and intracellular side by methane-thiosulphonate (MTS) reagents. Inhibits divalent transport upon extracellular application of (2-sulphonatoethyl)methane-thiosulphonate (MTSES) but not [2-(trimethylammonium)ethyl]methane-thiosulphonate (MTSET). Abolishes anion transport upon intracellular MTSET application.
- R405 (= R336) mutation to C: Fully abolishes anion transport.
P40879 Chloride anion exchanger; Down-regulated in adenoma; Protein DRA; Solute carrier family 26 member 3 from Homo sapiens (Human) (see 3 papers)
23% identity, 80% coverage: 10:475/580 of query aligns to 61:546/764 of P40879
- N153 (≠ A84) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N161 (≠ I92) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N165 (≠ H96) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- C307 (≠ A227) to W: in dbSNP:rs34407351
Sites not aligning to the query:
- 761:764 PDZ-binding; mutation Missing: Loss of interaction with NHERF4. No effect on localization to cell membrane or its exchanger activity.
P58735 Sulfate anion transporter 1; SAT-1; Solute carrier family 26 member 1 from Mus musculus (Mouse) (see paper)
24% identity, 96% coverage: 16:573/580 of query aligns to 59:702/704 of P58735
- T190 (= T105) mutation to M: Decreased sulfate-hydrogencarbonate exchange activity. Loss of localization to plasma membrane.
- S363 (≠ L293) mutation to L: Decreased sulfate-hydrogencarbonate exchange activity. Increased accumulation of protein in ER.
Sites not aligning to the query:
- 56 A→T: Decreased sulfate-hydrogencarbonate exchange activity. Does not affect localization to plasma membrane.
7lguA Structure of human prestin in the presence of nacl (see paper)
22% identity, 91% coverage: 16:542/580 of query aligns to 58:644/680 of 7lguA
Q62273 Sulfate transporter; Diastrophic dysplasia protein homolog; ST-OB; Solute carrier family 26 member 2 from Mus musculus (Mouse) (see paper)
22% identity, 94% coverage: 16:561/580 of query aligns to 98:715/739 of Q62273
- F368 (≠ E253) mutation to A: Reduced sulfate-chloride exchange activity.
- E417 (= E311) mutation E->A,K: Loss of sulfate-chloride exchange activity.
8sieC Pendrin in complex with bicarbonate
21% identity, 94% coverage: 16:561/580 of query aligns to 34:606/613 of 8sieC
- binding Lauryl Maltose Neopentyl Glycol: G198 (vs. gap), S296 (≠ R274), T300 (≠ G278), F303 (= F281)
- binding bicarbonate ion: Y65 (≠ L46), F101 (vs. gap), L356 (≠ I334), S357 (≠ A335), V403 (≠ L381), N406 (≠ V384)
- binding cholesterol: L226 (vs. gap), V255 (≠ G212), I262 (≠ L219), Y272 (≠ F233), F411 (vs. gap), V414 (≠ A391), V414 (≠ A391), C415 (≠ G392), C415 (≠ G392), I436 (≠ L413), M452 (≠ L430), F453 (≠ L431)
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: W421 (≠ L398), V429 (= V406), V432 (≠ L409), F433 (≠ L410), I436 (≠ L413)
8shcC Pendrin in complex with niflumic acid
21% identity, 94% coverage: 16:561/580 of query aligns to 34:606/613 of 8shcC
- binding cholesterol: I199 (vs. gap), A223 (≠ I184), V255 (≠ G212), Y272 (≠ F233), M412 (≠ S389), C415 (≠ G392), M452 (≠ L430), F453 (≠ L431)
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: Q156 (≠ R119), W421 (≠ L398), V432 (≠ L409), F433 (≠ L410), F455 (≠ A433)
- binding 2-{[3-(trifluoromethyl)phenyl]amino}nicotinic acid: Y65 (≠ L46), F101 (vs. gap), T173 (= T136), E252 (≠ L209), I312 (≠ E290), L356 (≠ I334), S357 (≠ A335), V402 (≠ L380), N406 (≠ V384)
8sgwC Pendrin in complex with chloride
21% identity, 94% coverage: 16:561/580 of query aligns to 34:606/613 of 8sgwC
- binding Lauryl Maltose Neopentyl Glycol: G198 (vs. gap), S296 (≠ R274), T300 (≠ G278), F303 (= F281)
- binding cholesterol: I228 (vs. gap), V255 (≠ G212), I262 (≠ L219), Y272 (≠ F233), K408 (≠ W386), F411 (vs. gap), M412 (≠ S389), M412 (≠ S389), V414 (≠ A391), C415 (≠ G392), V417 (= V394), I439 (≠ V417)
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: F159 (≠ R122), Y163 (= Y126), F284 (≠ G244), P286 (= P246), I289 (≠ L249), F343 (≠ V321), F346 (≠ L324), W421 (≠ L398), F433 (≠ L410), I436 (≠ L413), F455 (≠ A433), F464 (vs. gap), P465 (vs. gap)
Query Sequence
>Pf6N2E2_5239 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5239
MSFSAPPLFAAWRQAWRAGYTLERLRGDLVAGLTVGIIAIPLAMALAIAVGVPPQHGLYT
VLVAAPLIALTGGSRFNVSGPTAAFVVILLPITQQHGLGGLLLCTMLAGLILITLGLMRA
GRLIQYIPYPVILGFTAGIGVVIATLQLKDLLGLTTVGQAKHYIEQLGELIVALPSARLG
DGIIGVTCLAVLFAWPRWVPRVPGHLVALLVGALLGLALERGGWPVATLGERFSYMVDGI
SHPGIPPFLPSFEWPWNLPDGQGHPLTLSYDLIRQLLGPAFAIAMLGAIESLLCAVVADG
MTGSKHDPNAELIGQGLGNLVAPLFGGITATAAIARSATNVRSGASSPLAAIIHSLVVLL
AMVLLAPLFSYLPMAALAALLVIVAWNMSEAGHVLHTLRIAPRSDVLVLLTCLSLTVLFD
MVMAVAVGLLLAAGLFIKRMSELTDSAELPRHFHQALLDMPEHVRCYAIRGPLFFGAAEK
ALDVLRKFDPGVRVVVVEMSAVPMLDMTALAAFENILKDYRKQGIGLILVATAPRVRLKL
RRAGIHREQRQLAYVQTLEQARVKSEQWLASGSNAHPRLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory