SitesBLAST
Comparing Pf6N2E2_5274 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5274 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
27% identity, 98% coverage: 4:235/236 of query aligns to 6:242/250 of 5bt9C
- active site: R18 (= R16), I140 (= I133), Y155 (= Y148), K159 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R16), I19 (≠ V17), C38 (≠ T35), N39 (≠ Y36), R40 (= R37), S41 (≠ T38), L66 (≠ S60), E67 (= E61), N90 (= N84), S92 (= S86), I140 (= I133), K159 (= K152), P184 (= P177), G185 (≠ A178), T187 (≠ L180), L188 (= L181)
4cmjA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 4cmjA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), S190 (≠ L180)
- binding 6-(4-bromophenyl)-5-phenyl-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: S94 (= S86), F96 (≠ W88), D144 (= D135), M146 (≠ V137), C151 (≠ S142), Y157 (= Y148), P193 (vs. gap), M196 (vs. gap), W204 (≠ A189)
4cmcA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 4cmcA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L142 (≠ I133), C143 (≠ S134), D144 (= D135), K161 (= K152), P187 (= P177), G188 (≠ A178), V189 (≠ L179), S190 (≠ L180)
- binding N4-cyclohexyl-5,6-diphenyl-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: R13 (= R16), S94 (= S86), F96 (≠ W88), D144 (= D135), Y157 (= Y148), G188 (≠ A178), L192 (≠ F182)
4cmbA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 4cmbA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), V189 (≠ L179), S190 (≠ L180)
- binding N4-cyclohexyl-5-(4-fluorophenyl)-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: R13 (= R16), S94 (= S86), F96 (≠ W88), Y157 (= Y148), W204 (≠ A189)
4cm4A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 4cm4A
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 5-(4-fluorophenyl)-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: S94 (= S86), F96 (≠ W88), Y157 (= Y148), L192 (≠ F182), P193 (vs. gap), W204 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), K161 (= K152), P187 (= P177), G188 (≠ A178), S190 (≠ L180)
4cm3A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 4cm3A
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 5-phenyl-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: S94 (= S86), F96 (≠ W88), Y157 (= Y148), P193 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), S190 (≠ L180)
4clxA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 4clxA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), S94 (= S86), T117 (≠ V106), K161 (= K152), P187 (= P177), G188 (≠ A178), V189 (≠ L179), S190 (≠ L180)
- binding 2-amino-5-(p-tolyl)-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one: S94 (= S86), F96 (≠ W88), Y157 (= Y148), P193 (vs. gap), W204 (≠ A189)
4cloA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 4cloA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), C143 (≠ S134), K161 (= K152), P187 (= P177), G188 (≠ A178), S190 (≠ L180)
- binding 5-(phenylethynyl)-4-(pyrrolidin-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine: S94 (= S86), F96 (≠ W88), Y157 (= Y148), L192 (≠ F182), P193 (vs. gap), W204 (≠ A189)
4cldA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 4cldA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 2-amino-4-thiomorpholino-7H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile: F96 (≠ W88), D144 (= D135), Y157 (= Y148), L192 (≠ F182), P193 (vs. gap), W204 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), S190 (≠ L180)
4cl8A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 4cl8A
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), V189 (≠ L179), S190 (≠ L180)
- binding 2,4-diamino-6-(3-formylphenyl)-7H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile: S94 (= S86), F96 (≠ W88), C151 (≠ S142), Y157 (= Y148), G188 (≠ A178)
3mcvA Structure of ptr1 from trypanosoma brucei in ternary complex with 2,4- diamino-5-[2-(2,5-dimethoxyphenyl)ethyl]thieno[2,3-d]-pyrimidine and NADP+ (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 3mcvA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 5-[2-(2,5-dimethoxyphenyl)ethyl]thieno[2,3-d]pyrimidine-2,4-diamine: S94 (= S86), F96 (≠ W88), C151 (≠ S142), Y157 (= Y148), P193 (vs. gap), M196 (vs. gap), W204 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), S190 (≠ L180), L191 (= L181)
2yhuA Trypanosoma brucei ptr1 in complex with inhibitor whf30 (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 2yhuA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), S190 (≠ L180), L191 (= L181)
- binding 3-(5-amino-1,3,4-thiadiazol-2-yl)-1-thiophen-2-ylpropan-1-one: S94 (= S86), F96 (≠ W88), P193 (vs. gap), W204 (≠ A189)
2x9gA High resolution structure of tbptr1 in complex with pemetrexed (see paper)
28% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 2x9gA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 2-{4-[2-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-5-yl)-ethyl]-benzoylamino}-pentanedioic acid: S94 (= S86), F96 (≠ W88), F154 (≠ H145), Y157 (= Y148), P193 (vs. gap), M196 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), V189 (≠ L179), S190 (≠ L180)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
29% identity, 96% coverage: 9:234/236 of query aligns to 10:239/241 of 5t2uA
- active site: G17 (≠ R16), T135 (≠ D135), T145 (≠ H145), Y148 (= Y148), K152 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), G17 (≠ R16), R38 (= R37), D39 (≠ T38), R42 (≠ P41), D60 (≠ E61), L61 (≠ A62), N83 (= N84), A84 (= A85), Y87 (≠ W88), I133 (= I133), T135 (≠ D135), Y148 (= Y148), K152 (= K152), P178 (= P177), P180 (≠ L179), T181 (≠ L180), T183 (vs. gap), T185 (vs. gap), T186 (vs. gap)
4clhA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:246/252 of 4clhA
- active site: R13 (= R16), D145 (= D135), Y158 (= Y148), K162 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H32 (≠ T35), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L143 (≠ I133), K162 (= K152), P188 (= P177), G189 (≠ A178), S191 (≠ L180)
- binding 4-thiomorpholino-7H-pyrrolo[2,3-d]pyrimidin-2-amine: S94 (= S86), F96 (≠ W88), F96 (≠ W88), D145 (= D135), C152 (≠ S142), F155 (≠ H145), Y158 (= Y148), P194 (vs. gap), W205 (≠ A189)
4cleA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:246/252 of 4cleA
- active site: R13 (= R16), D145 (= D135), Y158 (= Y148), K162 (= K152)
- binding 4-(pyrrolidin-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine: S94 (= S86), F96 (≠ W88), F96 (≠ W88), D145 (= D135), C152 (≠ S142), Y158 (= Y148), G189 (≠ A178), P194 (vs. gap), W205 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), K162 (= K152), P188 (= P177), S191 (≠ L180)
6geyA Trypanosoma brucei ptr1 in complex with inhibitor 4g (f125) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 7:246/252 of 6geyA
- active site: R14 (= R16), D145 (= D135), Y158 (= Y148), K162 (= K152)
- binding 2-azanyl-~{N}-[(3,4-dichlorophenyl)methyl]-1,3-benzothiazole-6-carboxamide: S95 (= S86), F97 (≠ W88), C152 (≠ S142), Y158 (= Y148), P194 (vs. gap), M197 (vs. gap), W205 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R14 (= R16), I15 (≠ V17), H33 (≠ T35), Y34 (= Y36), H35 (≠ R37), N36 (≠ T38), S37 (≠ E39), D62 (= D57), L63 (≠ F58), N93 (= N84), A94 (= A85), S95 (= S86), T118 (≠ V106), L143 (≠ I133), D145 (= D135), K162 (= K152), P188 (= P177), G189 (≠ A178), S191 (≠ L180), L192 (= L181)
6gdpA Trypanosoma brucei ptr1 in complex with inhibitor 4l (f162) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 7:246/252 of 6gdpA
- active site: R14 (= R16), D145 (= D135), Y158 (= Y148), K162 (= K152)
- binding 2-azanyl-~{N}-(diphenylmethyl)-1,3-benzothiazole-6-carboxamide: S95 (= S86), F97 (≠ W88), M147 (≠ V137), C152 (≠ S142), Y158 (= Y148), V190 (≠ L179), W205 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R14 (= R16), I15 (≠ V17), Y34 (= Y36), H35 (≠ R37), N36 (≠ T38), S37 (≠ E39), D62 (= D57), L63 (≠ F58), N93 (= N84), A94 (= A85), S95 (= S86), T118 (≠ V106), L143 (≠ I133), K162 (= K152), P188 (= P177), G189 (≠ A178), V190 (≠ L179), S191 (≠ L180), L192 (= L181)
6gcqA Trypanosoma brucei ptr1 in complex with inhibitor 2b (f192) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 6gcqA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 6-(trifluoromethylsulfanyl)-1,3-benzothiazol-2-amine: S94 (= S86), F96 (≠ W88), Y157 (= Y148), L192 (≠ F182), P193 (vs. gap), W204 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ Q15), R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), V189 (≠ L179), S190 (≠ L180), L191 (= L181)
6gcpA Trypanosoma brucei ptr1 in complex with inhibitor 2d (f186) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:245/251 of 6gcpA
- active site: R13 (= R16), D144 (= D135), Y157 (= Y148), K161 (= K152)
- binding 6-[(3,4-dichlorophenyl)methylsulfanyl]-1,3-benzothiazol-2-amine: S94 (= S86), F96 (≠ W88), C151 (≠ S142), F154 (≠ H145), Y157 (= Y148), P193 (vs. gap), M196 (vs. gap), W204 (≠ A189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ T38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), S94 (= S86), T117 (≠ V106), L142 (≠ I133), K161 (= K152), P187 (= P177), G188 (≠ A178), S190 (≠ L180), L191 (= L181)
Query Sequence
>Pf6N2E2_5274 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5274
MSSATAPILITGAAQRVGLHCARRLLEDGQPVIATYRTERPGVQTLRDLGAVMLFADFSS
EAGILAFIEQLKQHTDRLRAIVHNASAWLAEGPGCEAAAFKAMFGVHMLAPYLINLHGAE
LLRRSTPADIVHISDDVTRKGSARHIAYCATKAGLESLTLSFAAKFAPAIKVNGIAPALL
LFNPEDDAAYRAKALAKSALGIEPGSEVIYQSLRYLLDNPYVTGTTLTVNGGRHVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory