Comparing Pf6N2E2_5395 Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
45% identity, 99% coverage: 3:244/244 of query aligns to 18:260/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
46% identity, 96% coverage: 11:244/244 of query aligns to 1:235/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
45% identity, 97% coverage: 8:244/244 of query aligns to 1:238/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
45% identity, 97% coverage: 8:244/244 of query aligns to 1:238/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
45% identity, 97% coverage: 8:244/244 of query aligns to 1:238/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
45% identity, 97% coverage: 8:244/244 of query aligns to 1:238/238 of 1lafE
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
43% identity, 95% coverage: 11:243/244 of query aligns to 26:259/260 of P0AEU0
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
43% identity, 97% coverage: 8:243/244 of query aligns to 1:237/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
43% identity, 95% coverage: 11:243/244 of query aligns to 26:259/260 of P02910
Sites not aligning to the query:
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
41% identity, 93% coverage: 12:237/244 of query aligns to 5:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
41% identity, 93% coverage: 12:237/244 of query aligns to 5:223/225 of 4zv2A
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
36% identity, 93% coverage: 11:237/244 of query aligns to 6:227/228 of 2y7iA
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
40% identity, 93% coverage: 12:237/244 of query aligns to 3:225/225 of 3tqlA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 93% coverage: 12:238/244 of query aligns to 11:229/229 of 5t0wA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
35% identity, 93% coverage: 12:239/244 of query aligns to 2:224/224 of 4ymxA
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
30% identity, 93% coverage: 13:240/244 of query aligns to 10:264/267 of 8hqrA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
35% identity, 92% coverage: 13:237/244 of query aligns to 12:227/229 of 6svfA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
29% identity, 94% coverage: 11:240/244 of query aligns to 2:251/256 of 5otcA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
29% identity, 94% coverage: 11:240/244 of query aligns to 2:251/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
29% identity, 94% coverage: 11:240/244 of query aligns to 2:251/254 of 5ot9A
>Pf6N2E2_5395 Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein
LASSSLFAAEKTLRIGIEAAYPPFASKTSEGKIVGFDYDIGNALCAQMQVKCEWIEGEFD
GLIPALKVKKIDLALSSMTITEERKKSVDFTHKYYFTSSRLVMKEGAVVDDQYVNLKGKT
VGVQRATTTDRYATEVLEPKGVSVKRYSNNEEIYMDLASGRLDAIFADTIPLEDFLSMPR
GKGYAFVGPELKDPKYVGEGAGIAVRKGNTQLVADLNKAIDGIRANGEYQKIQGKYFKSD
IYGD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory