Comparing Pf6N2E2_5486 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5486 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
28% identity, 35% coverage: 88:242/439 of query aligns to 63:201/446 of A0A0H2VG78
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 70% coverage: 78:384/439 of query aligns to 186:499/616 of P36035
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 35% coverage: 82:235/439 of query aligns to 98:258/583 of Q9Y7Q9
Sites not aligning to the query:
P14142 Solute carrier family 2, facilitated glucose transporter member 4; GT2; Glucose transporter type 4, insulin-responsive; GLUT-4 from Mus musculus (Mouse) (see paper)
26% identity, 38% coverage: 15:180/439 of query aligns to 15:187/509 of P14142
Q6PXP3 Solute carrier family 2, facilitated glucose transporter member 7; Glucose transporter type 7; GLUT-7; hGLUT7 from Homo sapiens (Human) (see paper)
19% identity, 77% coverage: 92:431/439 of query aligns to 100:470/512 of Q6PXP3
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 54% coverage: 3:238/439 of query aligns to 18:270/572 of O42885
Sites not aligning to the query:
8fvzA Pipt y150a
26% identity, 45% coverage: 24:219/439 of query aligns to 2:200/433 of 8fvzA
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 35% coverage: 92:245/439 of query aligns to 93:230/580 of Q9C757
Sites not aligning to the query:
P14672 Solute carrier family 2, facilitated glucose transporter member 4; Glucose transporter type 4, insulin-responsive; GLUT-4 from Homo sapiens (Human) (see 6 papers)
25% identity, 38% coverage: 15:180/439 of query aligns to 15:187/509 of P14672
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 41% coverage: 82:260/439 of query aligns to 117:317/587 of P25297
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 70% coverage: 72:379/439 of query aligns to 55:342/403 of P77589
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
22% identity, 49% coverage: 21:233/439 of query aligns to 37:230/444 of Q8NLB7
Sites not aligning to the query:
>Pf6N2E2_5486 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5486
MDNSNALPLGSAAVPARERTTASRIKSIFSGSVGNMVEWYDWYVYAAFSLYFAKVFFPKG
DTTAQLLNTAAIFAVGFLMRPIGGWLMGLYADRAGRKRALMASVYLMCFGSLIIALSPSY
ETIGVGAPILLVFARLLQGLSVGGEYGTSATYLSEMATKERRGFFSSFQYVTLISGQLIA
LGVLIVLQQFLTTEQLYAWGWRIPFAIGALCAIVALYLRRGMEETESFTKKEKAKESAMR
TLLRHPKELMTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQ
PVIGGLSDKIGRRPILIAFGILGTLFTVPILTTLHTIQTWWGAFFLIMAALIIVSGYTSI
NAVVKAELFPTEIRALGVGLPYALTVSIFGGTAEYIALWFKSIGMETGYYWYVTACIAVS
LLVYITMKDTRKHSRIVTD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory