SitesBLAST
Comparing Pf6N2E2_5707 Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
28% identity, 90% coverage: 4:409/450 of query aligns to 9:421/425 of O59010
- S65 (≠ T58) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S269) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 269:271) binding
- M311 (≠ L304) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T307) binding
- V355 (= V348) binding
- D394 (≠ S382) binding
- M395 (≠ E383) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R385) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N389) binding
- D405 (≠ N393) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
28% identity, 88% coverage: 6:402/450 of query aligns to 2:405/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
28% identity, 89% coverage: 4:402/450 of query aligns to 9:414/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (= F39), F46 (= F39), P75 (≠ N68), L91 (≠ I85), F95 (≠ I89), L130 (≠ I131), I133 (≠ F134), I159 (≠ V160), Y167 (vs. gap), K196 (≠ I189), G200 (≠ M193), I207 (= I200), F210 (= F203), L250 (≠ I243), I262 (= I255), M269 (≠ L262), T334 (≠ D327), V335 (≠ L328), G336 (≠ T329), T340 (= T333), L343 (= L336), M399 (≠ L387)
- binding aspartic acid: S277 (= S270), S278 (= S271), T314 (= T307), G354 (= G347), A358 (≠ S351), G359 (= G352), D394 (≠ S382), R397 (= R385), T398 (≠ A386)
- binding sodium ion: Y89 (≠ F83), T92 (≠ V86), S93 (= S87), G306 (= G299), T308 (≠ S301), N310 (= N303), N310 (= N303), M311 (≠ L304), D312 (= D305), S349 (= S342), I350 (≠ K343), T352 (≠ A345), N401 (= N389), V402 (≠ L390), D405 (≠ N393)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
28% identity, 89% coverage: 4:402/450 of query aligns to 6:411/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G62), V83 (≠ L80), I157 (≠ L161), Y164 (vs. gap), K193 (≠ I189), T305 (≠ S301), I306 (≠ F302), I347 (≠ K343)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L11), M199 (= M195), S275 (= S271), T311 (= T307), G356 (= G352), L384 (= L375), D391 (≠ S382), R394 (= R385)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
28% identity, 89% coverage: 4:402/450 of query aligns to 1:406/408 of 6bauA
- binding cysteine: S270 (= S271), M303 (≠ L304), T306 (= T307), A345 (= A346), G346 (= G347), V347 (= V348), G351 (= G352), D386 (≠ S382), C389 (≠ R385), T390 (≠ A386), N393 (= N389)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
28% identity, 89% coverage: 4:402/450 of query aligns to 1:406/409 of 6bavA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
29% identity, 90% coverage: 7:411/450 of query aligns to 11:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
29% identity, 90% coverage: 7:411/450 of query aligns to 11:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S269), S275 (= S270), S276 (= S271), T313 (= T307), G353 (= G347), V354 (= V348), A357 (≠ S351), G358 (= G352), D394 (≠ S382), R397 (= R385), T398 (≠ A386)
- binding decyl-beta-d-maltopyranoside: L194 (≠ I189), G198 (≠ M193), Y202 (≠ L197)
- binding sodium ion: Y87 (≠ F83), T90 (≠ V86), S91 (= S87), S276 (= S271), G305 (= G299), A306 (≠ Y300), T307 (≠ S301), N309 (= N303), N309 (= N303), M310 (≠ L304), D311 (= D305), S348 (= S342), I349 (≠ K343), G350 (= G344), T351 (≠ A345), N401 (= N389), V402 (≠ L390), D405 (≠ N393)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
29% identity, 90% coverage: 7:411/450 of query aligns to 9:421/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
29% identity, 90% coverage: 7:411/450 of query aligns to 8:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ I189), G195 (≠ M193), R282 (≠ L279)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S269), S272 (= S270), S273 (= S271), M307 (≠ L304), T310 (= T307), G353 (= G350), A354 (≠ S351), R394 (= R385), T395 (≠ A386)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
29% identity, 90% coverage: 7:411/450 of query aligns to 4:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S269), S265 (= S271), M299 (≠ L304), T302 (= T307), T340 (≠ A345), G342 (= G347), V343 (= V348), G347 (= G352), D383 (≠ S382), R386 (= R385), T387 (≠ A386), N390 (= N389)
- binding decyl-beta-d-maltopyranoside: H23 (= H27), V212 (≠ L218), A216 (≠ G222)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
26% identity, 89% coverage: 4:402/450 of query aligns to 1:394/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
29% identity, 88% coverage: 22:418/450 of query aligns to 33:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V72), G89 (= G73), G92 (= G76), A95 (= A79), V96 (≠ L80), Y99 (≠ F83), M163 (≠ V160), F167 (= F164), F293 (≠ L294), V297 (≠ T298)
- binding aspartic acid: S268 (= S270), S269 (= S271), T306 (= T307), G346 (= G347), I347 (≠ V348), A350 (≠ S351), G351 (= G352), D380 (≠ S382), R383 (= R385), T384 (≠ A386)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
27% identity, 87% coverage: 22:411/450 of query aligns to 25:395/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I63), S80 (≠ V72), G81 (= G73), G84 (= G76), Y91 (≠ F83), M156 (≠ V160), F160 (= F164), F286 (≠ L294), V290 (≠ T298)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I55), I148 (= I152), S262 (= S271), S263 (≠ E272), A292 (≠ Y300), T293 (≠ S301), M296 (≠ L304), T299 (= T307), G329 (= G344), A336 (≠ S351), G337 (= G352), D366 (≠ S382), R369 (= R385), N373 (= N389)
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
28% identity, 82% coverage: 40:408/450 of query aligns to 46:420/425 of 7xr4A
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
28% identity, 82% coverage: 40:408/450 of query aligns to 47:419/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S270), S281 (= S271), T318 (= T307), G363 (= G352), M367 (≠ L356), V385 (≠ L375), D388 (= D378), R395 (= R385), T396 (≠ A386)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R379)
- binding cholesterol hemisuccinate: R80 (≠ K74), R84 (≠ Y78), I95 (= I89), I252 (≠ V239)
Sites not aligning to the query:
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
26% identity, 83% coverage: 40:413/450 of query aligns to 79:495/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
27% identity, 79% coverage: 40:394/450 of query aligns to 39:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T58), L58 (≠ V59), L65 (≠ M66), V339 (≠ K343), G340 (= G344), S343 (≠ G347), I344 (≠ V348)
- binding cholesterol: W188 (≠ K196), I227 (≠ V233), F250 (≠ I255), W257 (≠ L262), M379 (≠ A384), S382 (≠ L387)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S271), M300 (≠ L304), T303 (= T307), Y306 (= Y310), G348 (= G352), L349 (≠ F353), M352 (≠ L356), I366 (≠ L371), L369 (≠ I374), V370 (≠ L375), D373 (= D378), D377 (≠ S382), R380 (= R385), T381 (≠ A386), N384 (= N389)
Sites not aligning to the query:
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
25% identity, 90% coverage: 40:444/450 of query aligns to 82:542/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
Q15758 Neutral amino acid transporter B(0); ATB(0); Baboon M7 virus receptor; RD114/simian type D retrovirus receptor; Sodium-dependent neutral amino acid transporter type 2; Solute carrier family 1 member 5 from Homo sapiens (Human) (see 2 papers)
26% identity, 81% coverage: 53:416/450 of query aligns to 106:498/541 of Q15758
- N212 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 512 V → L: in dbSNP:rs3027961
Query Sequence
>Pf6N2E2_5707 Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate
MTTRQPLYKSLYFQVIVAIAIGILLGHFYPQTGVALKPFGDGFIKLIKMVIAPIIFCTVV
SGIGGMQNMKSVGKTGGYALLYFEIVSTIALLIGLVVVNIVQPGVGMHIDVSTLDTSKIA
GFINASKDQSIIAFILNVIPNTIVGAFANGDILQVLMFSVLFGFALHRLGAYGKPVLDFI
DRFAHVMFIIINMIMKLAPIGAFGAMAFTIGAYGVGSLVQLGQLMICFYITCVVFVLVVL
GAICRAHGFSVVKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGY
SFNLDGTSIYLTMAAVFIAQATDTPMDLTHQITLLLVLLLSSKGAAGVTGSGFIVLAATL
SAVGTLPVAGLALILGIDRFMSEARALTNLVGNAVATIVVAKWVKELDEDQLQTELASGG
RGIADVREDDEQIAAAQIAAAESSAPVTVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory