SitesBLAST
Comparing Pf6N2E2_5813 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5813 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
35% identity, 99% coverage: 3:385/388 of query aligns to 10:404/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: R23 (= R16), G40 (= G33), L41 (= L34)
- binding 2-oxoglutaric acid: D213 (≠ E193), P214 (= P194), Y215 (= Y195), G216 (≠ R196), E217 (= E197), G241 (= G221), T242 (= T222), I246 (≠ T226)
- binding (2E)-pent-2-enedioic acid: G40 (= G33), Y130 (= Y115), N184 (= N164), R376 (= R357)
- binding glutamic acid: S20 (= S13), V22 (≠ I15), L131 (= L116), V360 (≠ M340), A364 (≠ P344), R369 (≠ P349)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G89), S105 (= S90), Q106 (= Q91), Y130 (= Y115), N184 (= N164), D212 (= D192), P214 (= P194), Y215 (= Y195), T242 (= T222), S244 (= S224), K245 (= K225), R252 (= R232)
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
35% identity, 99% coverage: 3:385/388 of query aligns to 10:404/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: S20 (= S13), V22 (≠ I15), R23 (= R16), L131 (= L116), Q135 (= Q120), A364 (≠ P344), R369 (≠ P349)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: R23 (= R16), G40 (= G33), Y130 (= Y115), L131 (= L116), A132 (= A117), N184 (= N164), R376 (= R357)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G89), S105 (= S90), Q106 (= Q91), Y130 (= Y115), V179 (≠ I159), N184 (= N164), D212 (= D192), P214 (= P194), Y215 (= Y195), T242 (= T222), S244 (= S224), K245 (= K225), R252 (= R232)
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
35% identity, 99% coverage: 3:385/388 of query aligns to 10:404/404 of 3aowC
- binding 2-oxoglutaric acid: R23 (= R16), Y70 (= Y55), Y130 (= Y115), L275 (= L255)
- binding pyridoxal-5'-phosphate: G104 (= G89), S105 (= S90), Q106 (= Q91), Y130 (= Y115), V179 (≠ I159), N184 (= N164), D212 (= D192), P214 (= P194), Y215 (= Y195), T242 (= T222), S244 (= S224), K245 (= K225), R252 (= R232)
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
35% identity, 99% coverage: 3:385/388 of query aligns to 10:404/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G89), S105 (= S90), Q106 (= Q91), Y130 (= Y115), V179 (≠ I159), N184 (= N164), D212 (= D192), P214 (= P194), Y215 (= Y195), T242 (= T222), S244 (= S224), K245 (= K225), R252 (= R232)
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
38% identity, 99% coverage: 2:384/388 of query aligns to 5:391/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: I18 (= I15), R19 (= R16), G35 (= G32), G36 (= G33), G95 (= G89), S96 (= S90), Q97 (= Q91), Y121 (= Y115), N170 (= N164), D198 (= D192), Y201 (= Y195), S231 (≠ T222), S233 (= S224), K234 (= K225), R241 (= R232), R364 (= R357)
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
38% identity, 99% coverage: 2:384/388 of query aligns to 5:391/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G89), S96 (= S90), Q97 (= Q91), Y121 (= Y115), N170 (= N164), D198 (= D192), A200 (≠ P194), Y201 (= Y195), S231 (≠ T222), S233 (= S224), K234 (= K225), R241 (= R232)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
38% identity, 99% coverage: 2:384/388 of query aligns to 9:395/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I22 (= I15), R23 (= R16), G39 (= G32), G40 (= G33), G99 (= G89), S100 (= S90), Q101 (= Q91), Y125 (= Y115), N174 (= N164), D202 (= D192), Y205 (= Y195), S235 (≠ T222), S237 (= S224), K238 (= K225), R245 (= R232), R368 (= R357)
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
38% identity, 99% coverage: 2:384/388 of query aligns to 9:395/397 of Q72LL6
- S20 (= S13) mutation to E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- R23 (= R16) mutation to A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; mutation to Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- G40 (= G33) binding
- Y70 (= Y55) binding
- N174 (= N164) binding ; binding
- R245 (= R232) binding
- R368 (= R357) binding
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
34% identity, 98% coverage: 3:383/388 of query aligns to 7:400/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G89), S103 (= S90), Q104 (= Q91), Y128 (= Y115), V177 (≠ I159), N182 (= N164), D210 (= D192), P212 (= P194), Y213 (= Y195), T240 (= T222), S242 (= S224), K243 (= K225), R250 (= R232)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
37% identity, 99% coverage: 2:384/388 of query aligns to 6:387/389 of 2z1yA
- binding leucine: G32 (= G33), Y117 (= Y115), R360 (= R357)
- binding pyridoxal-5'-phosphate: G91 (= G89), S92 (= S90), Q93 (= Q91), Y117 (= Y115), N166 (= N164), D194 (= D192), Y197 (= Y195), S227 (≠ T222), S229 (= S224), K230 (= K225), R237 (= R232)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
32% identity, 96% coverage: 9:381/388 of query aligns to 22:412/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G89), S113 (= S90), Q114 (= Q91), Y138 (= Y115), N194 (= N164), D222 (= D192), P224 (= P194), Y225 (= Y195), T252 (= T222), S254 (= S224), K255 (= K225), R262 (= R232)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
28% identity, 97% coverage: 6:381/388 of query aligns to 10:403/405 of 2zc0A
- active site: Y132 (= Y115), D214 (= D192), A216 (≠ P194), S246 (= S224)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G89), G107 (≠ S90), T108 (≠ Q91), Y132 (= Y115), N186 (= N164), D214 (= D192), A216 (≠ P194), Y217 (= Y195), T244 (= T222), S246 (= S224), K247 (= K225), R254 (= R232)
4ge4A Kynurenine aminotransferase ii inhibitors (see paper)
28% identity, 92% coverage: 27:383/388 of query aligns to 29:419/422 of 4ge4A
- binding (5-hydroxy-4-{[(1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G34 (= G32), G35 (= G33), L36 (= L34), Y68 (= Y55), G110 (= G89), S111 (= S90), Q112 (= Q91), Y136 (= Y115), N196 (= N164), D224 (= D192), P226 (= P194), Y227 (= Y195), S254 (≠ T222), S256 (= S224), K257 (= K225), R264 (= R232), R393 (= R357)
Sites not aligning to the query:
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
28% identity, 92% coverage: 27:383/388 of query aligns to 33:425/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G33), L40 (= L34), Y74 (= Y55), S117 (= S90), Q118 (= Q91), Y142 (= Y115), N202 (= N164), D230 (= D192), P232 (= P194), Y233 (= Y195), S260 (≠ T222), S262 (= S224), K263 (= K225), R270 (= R232), R399 (= R357)
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
28% identity, 92% coverage: 27:383/388 of query aligns to 33:425/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G33), L40 (= L34), Y74 (= Y55), S75 (≠ G56), S77 (= S58), S117 (= S90), Q118 (= Q91), Y142 (= Y115), N202 (= N164), D230 (= D192), P232 (= P194), Y233 (= Y195), S260 (≠ T222), S262 (= S224), R270 (= R232), L293 (= L255), R399 (= R357)
Sites not aligning to the query:
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
28% identity, 92% coverage: 27:383/388 of query aligns to 33:425/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G33), Y74 (= Y55), S75 (≠ G56), S77 (= S58), S117 (= S90), Q118 (= Q91), Y142 (= Y115), N202 (= N164), D230 (= D192), P232 (= P194), Y233 (= Y195), S260 (≠ T222), S262 (= S224), R270 (= R232), L293 (= L255), R399 (= R357)
Sites not aligning to the query:
4gdyB Kynurenine aminotransferase ii inhibitors
28% identity, 92% coverage: 27:383/388 of query aligns to 33:425/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: M33 (≠ V27), G39 (= G33), Y74 (= Y55), S75 (≠ G56), G116 (= G89), S117 (= S90), Q118 (= Q91), Y142 (= Y115), N202 (= N164), D230 (= D192), P232 (= P194), S260 (≠ T222), S262 (= S224), R270 (= R232), R399 (= R357)
Sites not aligning to the query:
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
28% identity, 93% coverage: 25:383/388 of query aligns to 20:414/414 of 2vgzA
3ue8A Kynurenine aminotransferase ii inhibitors (see paper)
28% identity, 95% coverage: 16:383/388 of query aligns to 5:408/410 of 3ue8A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G22 (= G33), Y57 (= Y55), S100 (= S90), Q101 (= Q91), Y125 (= Y115), N185 (= N164), D213 (= D192), P215 (= P194), Y216 (= Y195), S243 (≠ T222), S245 (= S224), K246 (= K225), R253 (= R232), R382 (= R357)
2xh1A Crystal structure of human kat ii-inhibitor complex (see paper)
28% identity, 94% coverage: 20:383/388 of query aligns to 11:412/412 of 2xh1A
- binding (3s)-10-(4-aminopiperazin-1-yl)-9-fluoro-7-hydroxy-3-methyl-2,3-dihydro-8h-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylate: G26 (= G33), L27 (= L34), Y61 (= Y55), L280 (= L255)
- binding pyridoxal-5'-phosphate: S104 (= S90), Q105 (= Q91), Y129 (= Y115), D217 (= D192), P219 (= P194), S247 (≠ T222), S249 (= S224), R257 (= R232)
Query Sequence
>Pf6N2E2_5813 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5813
MAFSERVSRLKSSLIREILAAAQRPEVMSFAGGLPAEAMLPKVEWAAMPLSMGQYGMSEG
EPALREALAAQARALGVACEASQVLVVSGSQQTLDLAAKLHIDVGTEVMLEAPTYLAALQ
IFQLFGADCITVPLEADGPDLKALRARLERHRPAFIYLIPTFQNPSAVRYSEAKRDAVAA
LLDEFGVTLIEDEPYRELTFDGGSATPIVSRLRKASWIYTGTVSKTLLPGLRVGYLIASP
DLFPHLLRLKQSADLHTNRIGQWQALQWIGTEQYRRHLSELRDFYRDRRDRFQAALEKHF
TDLADWNIPQGGLFFWLTLKQPLDTRTLLAAALAADVAFMPGEPFFPEPDQHPGHLRLNF
SHIDPARLDEGLKRLAGVVREALAAKAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory