SitesBLAST – Find functional sites

 

SitesBLAST

Comparing Pf6N2E2_5938 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 20 (the maximum) hits to proteins with known functional sites (download)

1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
41% identity, 92% coverage: 2:144/156 of query aligns to 6:148/162 of 1t3qA

query
sites
1t3qA
I
 
I
T
 
S
L
 
A
K
 
T
L
 
I
N
 
N
G
 
G
K
 
K
D
 
P
H
 
R
Q
 
V
L
 
F
D
 
Y
V
 
V
T
 
E
E
 
P
D
 
R
M
 
M
P
 
H
L
 
L
L
 
A
W
 
D
A
 
A
I
 
L
R
 
R
D
 
E
V
 
V
A
 
V
G
 
G
Y
 
L
N
 
T
G
 
G
T
 
T
K
 
K
F
x
I
G
|
G
C
|
C
G
x
E
M
x
Q
G
|
G
L
x
V
C
|
C
G
|
G
A
x
S
C
|
C
T
 
T
I
 
I
H
 
L
I
 
I
D
 
D
G
 
G
A
 
A
P
 
P
A
 
M
R
|
R
S
 
S
C
|
C
I
 
L
T
 
T
P
 
L
I
 
A
G
 
V
S
 
Q
V
 
A
K
 
E
G
 
G
L
 
C
D
 
S
I
 
I
S
 
E
T
 
T
I
 
V
D
 
E
G
 
G
L
 
L
H
 
S
A
 
Q
D
 
G
P
 
E
V
 
K
G
 
L
Q
 
N
I
 
A
V
 
L
Q
 
Q
K
 
D
A
 
S
W
 
F
L
 
R
D
 
R
T
 
H
A
 
H
V
 
A
A
x
L
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
T
G
 
A
G
 
G
Q
 
M
I
 
L
M
 
A
S
 
T
A
 
A
T
 
R
A
 
S
L
 
I
L
 
L
K
 
A
T
 
E
N
 
N
P
 
P
N
 
A
P
 
P
S
 
S
D
 
R
E
 
D
Q
 
E
I
 
V
E
 
R
E
 
E
A
 
V
M
 
M
V
 
S
G
 
G
N
 
N
I
 
L
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
E
R
 
T
I
 
I
K
 
I
T
 
D
A
 
A
I
 
I

5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
39% identity, 96% coverage: 2:151/156 of query aligns to 5:155/157 of 5y6qA

query
sites
5y6qA
I
 
L
T
 
T
L
 
M
K
 
Q
L
 
V
N
 
N
G
 
G
K
 
Q
D
 
P
H
 
Y
Q
 
P
L
 
M
D
 
E
V
 
I
T
 
D
E
 
P
D
 
R
M
 
V
P
 
T
L
 
L
L
 
L
W
 
D
A
 
A
I
 
L
R
 
R
D
 
E
V
 
H
A
 
L
G
 
N
Y
 
L
N
 
T
G
 
G
T
 
T
K
 
K
F
x
K
G
|
G
C
|
C
G
x
D
M
 
Q
G
|
G
L
x
Q
C
|
C
G
|
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
L
I
 
V
D
 
N
G
 
G
A
 
Q
P
 
R
A
 
V
R
 
L
S
 
S
C
|
C
I
 
L
T
 
T
P
 
L
I
 
A
G
 
A
S
 
Q
V
 
A
K
 
D
G
 
G
L
 
A
D
 
E
I
 
V
S
 
T
T
 
S
I
 
I
D
 
E
G
 
G
L
 
L
H
 
Q
A
 
S
D
 
-
P
 
A
V
 
S
G
 
G
Q
 
E
I
 
L
-
 
H
-
 
P
V
 
V
Q
 
Q
K
 
R
A
 
C
W
 
F
L
 
V
D
 
E
T
 
N
A
 
D
V
 
A
A
x
F
Q
|
Q
C
|
C
G
|
G
Y
 
Y
C
|
C
Q
 
T
G
 
P
G
 
G
Q
 
Q
I
 
I
M
 
M
S
 
S
A
 
A
T
 
V
A
 
A
L
 
C
L
 
I
K
 
K
T
 
E
N
 
G
P
 
H
N
 
A
P
 
G
S
 
S
D
 
D
E
 
D
Q
 
E
I
 
I
E
 
R
E
 
E
A
 
Y
M
 
M
V
 
S
G
 
G
N
 
N
I
 
L
C
|
C
R
|
R
C
|
C
G
 
G
T
 
A
Y
 
Y
N
 
P
R
 
H
I
 
I
K
 
I
T
 
D
A
 
A
I
 
I
R
 
K
Q
 
Q
A
 
A
S
 
A
T
 
A
H
 
E
L
 
M

4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
38% identity, 96% coverage: 2:151/156 of query aligns to 12:160/161 of 4zohC

query
sites
4zohC
I
 
I
T
 
T
L
 
L
K
 
K
L
 
I
N
 
N
G
 
G
K
 
E
D
 
K
H
 
Y
Q
 
E
L
 
T
D
 
E
V
 
V
T
 
E
E
 
P
D
 
R
M
 
R
P
 
L
L
 
L
L
 
V
W
 
H
A
 
V
I
 
L
R
 
R
D
 
E
V
 
L
A
 
-
G
 
G
Y
 
F
N
 
T
G
 
G
T
 
V
K
 
H
F
x
I
G
|
G
C
|
C
G
 
D
M
 
T
G
x
S
L
x
N
C
|
C
G
|
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
I
I
 
M
D
 
N
G
 
G
A
 
K
P
 
S
A
 
V
R
 
K
S
 
S
C
|
C
I
 
T
T
 
V
P
 
L
I
 
A
G
 
V
S
 
E
V
 
A
K
 
D
G
 
G
L
 
A
D
 
E
I
 
I
S
 
L
T
 
T
I
 
V
D
 
E
G
 
G
L
 
L
H
 
A
A
 
K
D
 
D
P
 
G
V
 
K
G
 
L
Q
 
H
I
 
P
V
 
I
Q
 
Q
K
 
E
A
 
A
W
 
F
L
 
W
D
 
E
T
 
N
A
 
H
V
 
A
A
 
L
Q
|
Q
C
|
C
G
|
G
Y
 
Y
C
|
C
Q
 
T
G
 
P
G
 
G
Q
 
M
I
 
I
M
 
M
S
 
E
A
 
A
T
 
Y
A
 
W
L
 
L
L
 
L
K
 
R
T
 
E
N
 
K
P
 
P
N
 
N
P
 
P
S
 
T
D
 
E
E
 
E
Q
 
E
I
 
I
E
 
R
E
 
E
A
 
G
M
 
I
V
 
S
G
 
G
N
 
N
I
 
L
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
Q
R
 
N
I
 
I
K
 
V
T
 
K
A
 
A
I
 
I
R
 
K
Q
 
A
A
 
A
S
 
A
T
 
E
H
 
K
L
 
L

3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
38% identity, 99% coverage: 2:156/156 of query aligns to 6:160/160 of 3hrdD

query
sites
3hrdD
I
 
I
T
 
N
L
 
L
K
 
N
L
 
L
N
 
N
G
 
G
K
 
E
D
 
A
H
 
R
Q
 
S
L
 
I
D
 
V
V
 
T
T
 
E
E
 
P
D
 
N
M
 
K
P
 
R
L
 
L
L
 
L
W
 
D
A
 
L
I
 
L
R
 
R
D
 
E
V
 
D
A
 
F
G
 
G
Y
 
L
N
 
T
G
 
S
T
 
V
K
 
K
F
x
E
G
|
G
C
|
C
G
x
S
M
x
E
G
|
G
L
x
E
C
|
C
G
|
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
I
I
 
F
D
 
N
G
 
G
A
 
D
P
 
P
A
 
V
R
x
T
S
 
T
C
|
C
I
 
C
T
 
M
P
 
L
I
 
A
G
 
G
S
 
Q
V
 
A
K
 
D
G
 
E
L
 
S
D
 
T
I
 
I
S
 
I
T
 
T
I
 
L
D
 
E
G
 
G
L
 
V
H
 
A
A
 
E
D
 
D
P
 
G
V
 
K
G
 
P
Q
 
S
I
 
L
V
 
L
Q
 
Q
K
 
Q
A
 
C
W
 
F
L
 
L
D
 
E
T
 
A
A
 
G
V
 
A
A
 
V
Q
|
Q
C
|
C
G
|
G
Y
 
Y
C
|
C
Q
 
T
G
 
P
G
 
G
Q
 
M
I
 
I
M
 
L
S
 
T
A
 
A
T
 
K
A
 
A
L
 
L
L
 
L
K
 
D
T
 
K
N
 
N
P
 
P
N
 
D
P
 
P
S
 
T
D
 
D
E
 
E
Q
 
E
I
 
I
E
 
T
E
 
V
A
 
A
M
 
M
V
 
S
G
 
G
N
 
N
I
 
L
C
|
C
R
 
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
I
R
 
K
I
 
I
K
 
H
T
 
A
A
 
A
I
 
V
R
 
R
Q
 
Y
A
 
A
S
 
V
T
 
E
H
 
R
L
 
C
K
 
A
E
 
N
A
 
A
K
 
A
A
 
A

Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
39% identity, 94% coverage: 2:147/156 of query aligns to 6:151/157 of Q0QLF3

query
sites
Q0QLF3
I
 
I
T
 
N
L
 
L
K
 
N
L
 
L
N
 
N
G
 
G
K
 
E
D
 
A
H
 
R
Q
 
S
L
 
I
D
 
V
V
 
T
T
 
E
E
 
P
D
 
N
M
 
K
P
 
R
L
 
L
L
 
L
W
 
D
A
 
L
I
 
L
R
 
R
D
 
E
V
 
D
A
 
F
G
 
G
Y
 
L
N
 
T
G
 
S
T
 
V
K
 
K
F
 
E
G
 
G
C
|
C
G
 
S
M
 
E
G
 
G
L
 
E
C
|
C
G
 
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
I
I
 
F
D
 
N
G
 
G
A
 
D
P
 
P
A
 
V
R
 
T
S
 
T
C
|
C
I
 
C
T
 
M
P
 
L
I
 
A
G
 
G
S
 
Q
V
 
A
K
 
D
G
 
E
L
 
S
D
 
T
I
 
I
S
 
I
T
 
T
I
 
L
D
 
E
G
 
G
L
 
V
H
 
A
A
 
E
D
 
D
P
 
G
V
 
K
G
 
P
Q
 
S
I
 
L
V
 
L
Q
 
Q
K
 
Q
A
 
C
W
 
F
L
 
L
D
 
E
T
 
A
A
 
G
V
 
A
A
 
V
Q
 
Q
C
|
C
G
 
G
Y
 
Y
C
|
C
Q
 
T
G
 
P
G
 
G
Q
 
M
I
 
I
M
 
L
S
 
T
A
 
A
T
 
K
A
 
A
L
 
L
L
 
L
K
 
D
T
 
K
N
 
N
P
 
P
N
 
D
P
 
P
S
 
T
D
 
D
E
 
E
Q
 
E
I
 
I
E
 
T
E
 
V
A
 
A
M
 
M
V
 
S
G
 
G
N
 
N
I
 
L
C
|
C
R
 
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
I
R
 
K
I
 
I
K
 
H
T
 
A
A
 
A
I
 
V
R
 
R
Q
 
Y
A
 
A

1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
37% identity, 95% coverage: 1:148/156 of query aligns to 4:151/161 of 1sb3C

query
sites
1sb3C
M
 
I
I
 
L
T
 
R
L
 
L
K
 
T
L
 
L
N
 
N
G
 
G
K
 
R
D
 
A
H
 
R
Q
 
E
L
 
D
D
 
L
V
 
V
T
 
P
E
 
D
D
 
N
M
 
M
P
 
L
L
 
L
L
 
L
W
 
D
A
 
Y
I
 
L
R
 
R
D
 
E
V
 
T
A
 
V
G
 
G
Y
 
L
N
 
T
G
 
G
T
 
T
K
 
K
F
x
Q
G
|
G
C
|
C
G
 
D
M
 
G
G
|
G
L
x
E
C
|
C
G
|
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
L
I
 
V
D
 
D
G
 
D
A
 
R
P
 
P
A
 
R
R
x
L
S
 
A
C
|
C
I
 
S
T
 
T
P
 
L
I
 
A
G
 
H
S
 
Q
V
 
V
K
 
A
G
 
G
L
 
K
D
 
K
I
 
V
S
 
E
T
 
T
I
 
V
D
 
E
G
 
S
L
 
L
H
 
A
A
 
T
D
 
Q
P
 
G
V
 
T
G
 
L
Q
 
S
I
 
K
V
 
L
Q
 
Q
K
 
A
A
 
A
W
 
F
L
 
H
D
 
E
T
 
K
A
 
L
V
 
G
A
 
T
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
T
G
 
P
G
 
G
Q
 
M
I
 
I
M
 
M
S
 
A
A
 
S
T
 
E
A
 
A
L
 
L
L
 
L
K
 
R
T
 
K
N
 
N
P
 
P
N
 
S
P
 
P
S
 
S
D
 
R
E
 
D
Q
 
E
I
 
I
E
 
K
E
 
A
A
 
A
M
 
L
V
 
A
G
 
G
N
 
N
I
 
L
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
V
R
 
K
I
 
I
K
 
I
T
 
K
A
 
S
I
 
V
R
 
E
Q
 
T
A
 
A
S
 
A

1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
35% identity, 98% coverage: 1:153/156 of query aligns to 4:156/156 of 1ffuD

query
sites
1ffuD
M
 
I
I
 
I
T
 
T
L
 
V
K
 
N
L
 
V
N
 
N
G
 
G
K
 
K
D
 
A
H
 
Q
Q
 
E
L
 
K
D
 
A
V
 
V
T
 
E
E
 
P
D
 
R
M
 
T
P
 
L
L
 
L
L
 
I
W
 
H
A
 
F
I
 
L
R
 
R
D
 
E
V
 
E
A
 
L
G
 
N
Y
 
L
N
 
T
G
 
G
T
 
A
K
 
H
F
x
I
G
|
G
C
|
C
G
 
E
M
 
T
G
x
S
L
x
H
C
|
C
G
|
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
D
I
 
I
D
 
D
G
 
G
A
 
R
P
 
S
A
 
V
R
x
K
S
 
S
C
|
C
I
 
T
T
 
H
P
 
L
I
 
A
G
 
V
S
 
Q
V
 
C
K
 
D
G
 
G
L
 
S
D
 
E
I
 
V
S
 
L
T
 
T
I
 
V
D
 
E
G
 
G
L
 
L
H
 
A
A
 
N
D
 
K
P
 
G
V
 
V
G
 
L
Q
 
H
I
 
A
V
 
V
Q
 
Q
K
 
E
A
 
G
W
 
F
L
 
Y
D
 
K
T
 
E
A
 
H
V
 
G
A
 
L
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
T
G
 
P
G
 
G
Q
 
M
I
 
L
M
 
M
S
 
R
A
 
A
T
 
Y
A
 
R
L
 
F
L
 
L
K
 
Q
T
 
E
N
 
N
P
 
P
N
 
N
P
 
P
S
 
T
D
 
E
E
 
A
Q
 
E
I
 
I
E
 
R
E
 
M
A
 
G
M
 
M
V
 
T
G
 
G
N
 
N
I
 
L
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
Q
R
 
N
I
 
I
K
 
V
T
 
K
A
 
A
I
 
V
R
 
Q
Q
 
Y
A
 
A
S
 
A
T
 
R
H
 
K
L
 
L
K
 
Q
E
 
E

1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
35% identity, 98% coverage: 1:153/156 of query aligns to 3:155/155 of 1ffvA

query
sites
1ffvA
M
 
I
I
 
I
T
 
T
L
 
V
K
 
N
L
 
V
N
 
N
G
 
G
K
 
K
D
 
A
H
 
Q
Q
 
E
L
 
K
D
 
A
V
 
V
T
 
E
E
 
P
D
 
R
M
 
T
P
 
L
L
 
L
L
 
I
W
 
H
A
 
F
I
 
L
R
 
R
D
 
E
V
 
E
A
 
L
G
 
N
Y
 
L
N
 
T
G
 
G
T
 
A
K
 
H
F
x
I
G
|
G
C
|
C
G
 
E
M
x
T
G
x
S
L
x
H
C
|
C
G
|
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
D
I
 
I
D
 
D
G
 
G
A
 
R
P
 
S
A
 
V
R
x
K
S
 
S
C
|
C
I
 
T
T
 
H
P
 
L
I
 
A
G
 
V
S
 
Q
V
 
C
K
 
D
G
 
G
L
 
S
D
 
E
I
 
V
S
 
L
T
 
T
I
 
V
D
 
E
G
 
G
L
 
L
H
 
A
A
 
N
D
 
K
P
 
G
V
 
V
G
 
L
Q
 
H
I
 
A
V
 
V
Q
 
Q
K
 
E
A
 
G
W
 
F
L
 
Y
D
 
K
T
 
E
A
 
H
V
 
G
A
x
L
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
T
G
 
P
G
 
G
Q
 
M
I
 
L
M
 
M
S
 
R
A
 
A
T
 
Y
A
 
R
L
 
F
L
 
L
K
 
Q
T
 
E
N
 
N
P
 
P
N
 
N
P
 
P
S
 
T
D
 
E
E
 
A
Q
 
E
I
 
I
E
 
R
E
 
M
A
 
G
M
 
M
V
 
T
G
 
G
N
 
N
I
 
L
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
Q
R
 
N
I
 
I
K
 
V
T
 
K
A
 
A
I
 
V
R
 
Q
Q
 
Y
A
 
A
S
 
A
T
 
R
H
 
K
L
 
L
K
 
Q
E
 
E

P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
38% identity, 97% coverage: 2:152/156 of query aligns to 63:228/229 of P77165

query
sites
P77165
I
 
L
T
 
T
L
 
L
K
 
K
L
 
V
N
 
N
G
 
G
K
 
K
D
 
T
H
 
E
Q
 
Q
L
 
L
D
 
E
V
 
V
T
 
D
E
 
T
D
 
R
M
 
T
P
 
T
L
 
L
L
 
L
W
 
D
A
 
T
I
 
L
R
 
R
D
 
E
V
 
N
A
 
L
G
 
H
Y
 
L
N
 
I
G
 
G
T
 
T
K
 
K
F
 
K
G
 
G
C
|
C
G
 
D
M
 
H
G
 
G
L
 
Q
C
|
C
G
|
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
L
I
 
V
D
 
N
G
 
G
A
 
R
P
 
R
A
 
L
R
 
N
S
 
A
C
|
C
I
 
L
T
 
T
P
 
L
I
 
A
G
 
V
S
 
M
V
 
H
K
 
Q
G
 
G
L
 
A
D
 
E
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
L
H
 
G
A
 
S
D
 
P
P
 
D
V
 
N
G
 
L
Q
 
H
I
 
P
V
 
M
Q
 
Q
K
 
A
A
 
A
W
 
F
L
 
I
D
 
K
T
 
H
A
 
D
V
 
G
A
 
F
Q
 
Q
C
|
C
G
 
G
Y
 
Y
C
|
C
Q
 
T
G
 
S
G
 
G
Q
 
Q
I
 
I
M
 
C
S
 
S
A
 
S
T
 
V
A
 
A
L
 
V
L
 
L
K
 
K
-
 
E
-
 
I
-
 
Q
-
 
D
-
 
G
-
 
I
-
 
P
-
 
S
-
 
H
-
 
V
-
 
T
-
 
V
-
 
D
-
 
L
-
 
V
T
 
S
N
 
A
P
 
P
N
 
E
P
 
T
S
 
T
D
 
A
E
 
D
Q
 
E
I
 
I
E
 
R
E
 
E
A
 
R
M
 
M
V
 
S
G
 
G
N
 
N
I
 
I
C
|
C
R
 
R
C
|
C
G
 
G
T
 
A
Y
 
Y
N
 
A
R
 
N
I
 
I
K
 
L
T
 
A
A
 
A
I
 
I
R
 
E
Q
 
D
A
 
A
S
 
A
T
 
G
H
 
E
L
 
I
K
 
K

5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
38% identity, 94% coverage: 2:148/156 of query aligns to 12:173/175 of 5g5gA

query
sites
5g5gA
I
 
L
T
 
T
L
 
L
K
 
K
L
 
V
N
 
N
G
 
G
K
 
K
D
 
T
H
 
E
Q
 
Q
L
 
L
D
 
E
V
 
V
T
 
D
E
 
T
D
 
R
M
 
T
P
 
T
L
 
L
L
 
L
W
 
D
A
 
T
I
 
L
R
 
R
D
 
E
V
 
N
A
 
L
G
 
H
Y
 
L
N
 
I
G
 
G
T
 
T
K
 
K
F
x
K
G
|
G
C
|
C
G
x
D
M
 
H
G
|
G
L
x
Q
C
|
C
G
|
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
L
I
 
V
D
 
N
G
 
G
A
 
R
P
 
R
A
 
L
R
x
N
S
 
A
C
|
C
I
 
L
T
 
T
P
 
L
I
 
A
G
 
V
S
 
M
V
 
H
K
 
Q
G
 
G
L
 
A
D
 
E
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
L
H
 
G
A
 
S
D
 
P
P
 
D
V
 
N
G
 
L
Q
 
H
I
 
P
V
 
M
Q
 
Q
K
 
A
A
 
A
W
 
F
L
 
I
D
 
K
T
 
H
A
 
D
V
 
G
A
 
F
Q
|
Q
C
|
C
G
|
G
Y
 
Y
C
|
C
Q
 
T
G
 
S
G
 
G
Q
 
Q
I
 
I
M
 
C
S
 
S
A
 
S
T
 
V
A
 
A
L
 
V
L
 
L
K
 
K
-
 
E
-
 
I
-
 
Q
-
 
D
-
 
G
-
 
I
-
 
P
-
 
S
-
 
H
-
 
V
-
 
T
-
 
V
-
 
D
-
 
L
-
 
V
T
 
S
N
 
A
P
 
P
N
 
E
P
 
T
S
 
T
D
 
A
E
 
D
Q
 
E
I
 
I
E
 
R
E
 
E
A
 
R
M
 
M
V
 
S
G
 
G
N
 
N
I
 
I
C
|
C
R
 
R
C
|
C
G
 
G
T
 
A
Y
 
Y
N
 
A
R
 
N
I
 
I
K
 
L
T
 
A
A
 
A
I
 
I
R
 
E
Q
 
D
A
 
A
S
 
A

P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
35% identity, 97% coverage: 2:152/156 of query aligns to 6:157/166 of P19921

query
sites
P19921
I
 
I
T
 
E
L
 
L
K
 
T
L
 
I
N
 
N
G
 
G
K
 
H
D
 
P
H
 
V
Q
 
E
L
 
A
D
 
L
V
 
V
T
 
E
E
 
P
D
 
R
M
 
T
P
 
L
L
 
L
L
 
I
W
 
H
A
 
F
I
 
I
R
 
R
D
 
E
V
 
Q
A
 
Q
G
 
N
Y
 
L
N
 
T
G
 
G
T
 
A
K
 
H
F
 
I
G
 
G
C
|
C
G
 
D
M
 
T
G
 
S
L
 
H
C
|
C
G
 
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
D
I
 
L
D
 
D
G
 
G
A
 
M
P
 
S
A
 
V
R
 
K
S
 
S
C
|
C
I
 
T
T
 
M
P
 
F
I
 
A
G
 
V
S
 
Q
V
 
A
K
 
N
G
 
G
L
 
A
D
 
S
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
M
H
 
-
A
 
A
D
 
A
P
 
P
V
 
D
G
 
G
Q
 
T
I
 
L
-
 
S
-
 
A
V
 
L
Q
 
Q
K
 
E
A
 
G
W
 
F
L
 
R
D
 
M
T
 
M
A
 
H
V
 
G
A
 
L
Q
 
Q
C
|
C
G
 
G
Y
 
Y
C
|
C
Q
 
T
G
 
P
G
 
G
Q
 
M
I
 
I
M
 
M
S
 
R
A
 
S
T
 
H
A
 
R
L
 
L
L
 
L
K
 
Q
T
 
E
N
 
N
P
 
P
N
 
S
P
 
P
S
 
T
D
 
E
E
 
A
Q
 
E
I
 
I
E
 
R
E
 
F
A
 
G
M
 
I
V
 
G
G
 
G
N
 
N
I
 
L
C
|
C
R
 
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
Q
R
 
N
I
 
I
K
 
V
T
 
K
A
 
A
I
 
I
R
 
Q
Q
 
Y
A
 
A
S
 
A
T
 
A
H
 
K
L
 
I
K
 
N

1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
36% identity, 98% coverage: 3:155/156 of query aligns to 5:160/906 of 1dgjA

query
sites
1dgjA
T
 
T
L
 
L
K
 
I
L
 
V
N
 
N
G
 
G
K
 
M
D
 
A
H
 
R
Q
 
R
L
 
L
D
 
L
V
 
V
T
 
S
E
 
P
D
 
N
M
 
D
P
 
L
L
 
L
L
 
V
W
 
D
A
 
V
I
 
L
R
 
R
D
 
S
V
 
Q
A
 
L
G
 
Q
Y
 
L
N
 
T
G
 
S
T
 
V
K
 
K
F
x
V
G
|
G
C
|
C
G
|
G
M
 
K
G
|
G
L
x
Q
C
|
C
G
|
G
A
|
A
C
|
C
T
 
T
I
 
V
H
 
I
I
 
L
D
 
D
G
 
G
A
 
K
P
 
V
A
 
V
R
|
R
S
 
A
C
|
C
I
 
I
T
 
I
P
 
K
I
 
M
G
 
S
S
 
R
V
 
V
-
 
A
K
 
E
G
 
N
L
 
A
D
 
S
I
 
V
S
 
T
T
 
T
I
 
L
D
 
E
G
 
G
L
 
I
H
 
G
A
 
A
D
 
P
P
 
D
V
 
C
G
 
L
Q
 
H
I
 
P
V
 
L
Q
 
Q
K
 
H
A
 
A
W
 
W
L
 
I
D
 
Q
T
 
H
A
 
G
V
 
A
A
 
A
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
T
G
 
P
G
 
G
Q
 
F
I
 
I
M
 
V
S
 
S
A
 
A
T
 
K
A
 
A
L
 
L
L
 
L
K
 
D
T
 
E
N
 
N
P
 
V
N
 
A
P
 
P
S
 
S
D
 
R
E
 
E
Q
 
D
I
 
V
E
 
R
E
 
D
A
 
W
M
 
F
V
 
Q
G
 
K
-
 
H
-
 
H
N
 
N
I
 
I
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
K
R
 
P
I
 
L
K
 
V
T
 
D
A
 
A
I
 
V
R
 
M
Q
 
D
A
 
A
S
 
A
T
 
A
H
 
I
L
 
L
K
 
R
E
 
G
A
 
E
K
 
K

Sites not aligning to the query:

1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
35% identity, 97% coverage: 2:152/156 of query aligns to 4:155/161 of 1n5wA

query
sites
1n5wA
I
 
I
T
 
E
L
 
L
K
 
T
L
 
I
N
 
N
G
 
G
K
 
H
D
 
P
H
 
V
Q
 
E
L
 
A
D
 
L
V
 
V
T
 
E
E
 
P
D
 
R
M
 
T
P
 
L
L
 
L
L
 
I
W
 
H
A
 
F
I
 
I
R
 
R
D
 
E
V
 
Q
A
 
Q
G
 
N
Y
 
L
N
 
T
G
 
G
T
 
A
K
 
H
F
x
I
G
|
G
C
|
C
G
 
D
M
x
T
G
x
S
L
x
H
C
|
C
G
|
G
A
 
A
C
|
C
T
 
T
I
 
V
H
 
D
I
 
L
D
 
D
G
 
G
A
 
M
P
 
S
A
 
V
R
x
K
S
 
S
C
|
C
I
 
T
T
 
M
P
 
F
I
 
A
G
 
V
S
 
Q
V
 
A
K
 
N
G
 
G
L
 
A
D
 
S
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
M
H
 
-
A
 
A
D
 
A
P
 
P
V
 
D
G
 
G
Q
 
T
I
 
L
-
 
S
-
 
A
V
 
L
Q
 
Q
K
 
E
A
 
G
W
 
F
L
 
R
D
 
M
T
 
M
A
 
H
V
 
G
A
x
L
Q
|
Q
C
|
C
G
|
G
Y
 
Y
C
|
C
Q
 
T
G
 
P
G
 
G
Q
 
M
I
 
I
M
 
M
S
 
R
A
 
S
T
 
H
A
 
R
L
 
L
L
 
L
K
 
Q
T
 
E
N
 
N
P
 
P
N
 
S
P
 
P
S
 
T
D
 
E
E
 
A
Q
 
E
I
 
I
E
 
R
E
 
F
A
 
G
M
 
I
V
 
G
G
 
G
N
 
N
I
 
L
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
Q
R
 
N
I
 
I
K
 
V
T
 
K
A
 
A
I
 
I
R
 
Q
Q
 
Y
A
 
A
S
 
A
T
 
A
H
 
K
L
 
I
K
 
N

4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
36% identity, 93% coverage: 4:148/156 of query aligns to 6:153/907 of 4usaA

query
sites
4usaA
L
 
I
K
 
T
L
 
V
N
 
N
G
 
G
K
 
I
D
 
E
H
 
Q
Q
 
N
L
 
L
D
 
F
V
 
V
T
 
D
E
 
A
D
 
E
M
 
A
P
 
L
L
 
L
L
 
S
W
 
D
A
 
V
I
 
L
R
 
R
D
 
Q
V
 
Q
A
 
L
G
 
G
Y
 
L
N
 
T
G
 
G
T
 
V
K
 
K
F
x
V
G
|
G
C
|
C
G
x
E
M
 
Q
G
|
G
L
x
Q
C
|
C
G
|
G
A
 
A
C
|
C
T
 
S
I
 
V
H
 
I
I
 
L
D
 
D
G
 
G
A
 
K
P
 
V
A
 
V
R
|
R
S
 
A
C
|
C
I
 
V
T
 
T
P
 
K
I
 
M
G
 
K
S
 
R
V
 
V
-
 
A
K
 
D
G
 
G
L
 
A
D
 
Q
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
V
H
 
G
A
 
Q
D
 
P
P
 
E
V
 
N
G
 
L
Q
 
H
I
 
P
V
 
L
Q
 
Q
K
 
K
A
 
A
W
 
W
L
 
V
D
 
L
T
 
H
A
 
G
V
 
G
A
 
A
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
S
G
 
P
G
 
G
Q
 
F
I
 
I
M
 
V
S
 
S
A
 
A
T
 
K
A
 
G
L
 
L
L
 
L
K
 
D
T
 
T
N
 
N
P
 
A
N
 
D
P
 
P
S
 
S
D
 
R
E
 
E
Q
 
D
I
 
V
E
 
R
E
 
D
A
 
W
M
 
F
V
 
Q
G
 
K
-
 
H
-
 
R
N
 
N
I
 
A
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
K
R
 
P
I
 
L
K
 
V
T
 
D
A
 
A
I
 
V
R
 
M
Q
 
D
A
 
A
S
 
A

Sites not aligning to the query:

4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
36% identity, 93% coverage: 4:148/156 of query aligns to 6:153/907 of 4us9A

query
sites
4us9A
L
 
I
K
 
T
L
 
V
N
 
N
G
 
G
K
 
I
D
 
E
H
 
Q
Q
 
N
L
 
L
D
 
F
V
 
V
T
 
D
E
 
A
D
 
E
M
 
A
P
 
L
L
 
L
L
 
S
W
 
D
A
 
V
I
 
L
R
 
R
D
 
Q
V
 
Q
A
 
L
G
 
G
Y
 
L
N
 
T
G
 
G
T
 
V
K
 
K
F
x
V
G
|
G
C
|
C
G
x
E
M
 
Q
G
|
G
L
 
Q
C
|
C
G
|
G
A
 
A
C
|
C
T
 
S
I
 
V
H
 
I
I
 
L
D
 
D
G
 
G
A
 
K
P
 
V
A
 
V
R
|
R
S
 
A
C
|
C
I
 
V
T
 
T
P
 
K
I
 
M
G
 
K
S
 
R
V
 
V
-
 
A
K
 
D
G
 
G
L
 
A
D
 
Q
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
V
H
 
G
A
 
Q
D
 
P
P
 
E
V
 
N
G
 
L
Q
 
H
I
 
P
V
 
L
Q
 
Q
K
 
K
A
 
A
W
 
W
L
 
V
D
 
L
T
 
H
A
 
G
V
 
G
A
 
A
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
S
G
 
P
G
 
G
Q
 
F
I
 
I
M
 
V
S
 
S
A
 
A
T
 
K
A
 
G
L
 
L
L
 
L
K
 
D
T
 
T
N
 
N
P
 
A
N
 
D
P
 
P
S
 
S
D
 
R
E
 
E
Q
 
D
I
 
V
E
 
R
E
 
D
A
 
W
M
 
F
V
 
Q
G
 
K
-
 
H
-
 
R
N
 
N
I
 
A
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
K
R
 
P
I
 
L
K
 
V
T
 
D
A
 
A
I
 
V
R
 
M
Q
 
D
A
 
A
S
 
A

Sites not aligning to the query:

4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
36% identity, 93% coverage: 4:148/156 of query aligns to 6:153/907 of 4us8A

query
sites
4us8A
L
 
I
K
 
T
L
 
V
N
 
N
G
 
G
K
 
I
D
 
E
H
 
Q
Q
 
N
L
 
L
D
 
F
V
 
V
T
 
D
E
 
A
D
 
E
M
 
A
P
 
L
L
 
L
L
 
S
W
 
D
A
 
V
I
 
L
R
 
R
D
 
Q
V
 
Q
A
 
L
G
 
G
Y
 
L
N
 
T
G
 
G
T
 
V
K
 
K
F
x
V
G
|
G
C
|
C
G
x
E
M
 
Q
G
|
G
L
x
Q
C
|
C
G
|
G
A
 
A
C
|
C
T
 
S
I
 
V
H
 
I
I
 
L
D
 
D
G
 
G
A
 
K
P
 
V
A
 
V
R
|
R
S
 
A
C
|
C
I
 
V
T
 
T
P
 
K
I
 
M
G
 
K
S
 
R
V
 
V
-
 
A
K
 
D
G
 
G
L
 
A
D
 
Q
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
V
H
 
G
A
 
Q
D
 
P
P
 
E
V
 
N
G
 
L
Q
 
H
I
 
P
V
 
L
Q
 
Q
K
 
K
A
 
A
W
 
W
L
 
V
D
 
L
T
 
H
A
 
G
V
 
G
A
 
A
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
S
G
 
P
G
 
G
Q
 
F
I
 
I
M
 
V
S
 
S
A
 
A
T
 
K
A
 
G
L
 
L
L
 
L
K
 
D
T
 
T
N
 
N
P
 
A
N
 
D
P
 
P
S
 
S
D
 
R
E
 
E
Q
 
D
I
 
V
E
 
R
E
 
D
A
 
W
M
 
F
V
 
Q
G
 
K
-
 
H
-
 
R
N
 
N
I
 
A
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
K
R
 
P
I
 
L
K
 
V
T
 
D
A
 
A
I
 
V
R
 
M
Q
 
D
A
 
A
S
 
A

Sites not aligning to the query:

4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
36% identity, 93% coverage: 4:148/156 of query aligns to 6:153/907 of 4c7yA

query
sites
4c7yA
L
 
I
K
 
T
L
 
V
N
 
N
G
 
G
K
 
I
D
 
E
H
 
Q
Q
 
N
L
 
L
D
 
F
V
 
V
T
 
D
E
 
A
D
 
E
M
 
A
P
 
L
L
 
L
L
 
S
W
 
D
A
 
V
I
 
L
R
 
R
D
 
Q
V
 
Q
A
 
L
G
 
G
Y
 
L
N
 
T
G
 
G
T
 
V
K
 
K
F
x
V
G
|
G
C
|
C
G
x
E
M
 
Q
G
|
G
L
 
Q
C
|
C
G
|
G
A
 
A
C
|
C
T
 
S
I
 
V
H
 
I
I
 
L
D
 
D
G
 
G
A
 
K
P
 
V
A
 
V
R
|
R
S
 
A
C
|
C
I
 
V
T
 
T
P
 
K
I
 
M
G
 
K
S
 
R
V
 
V
-
 
A
K
 
D
G
 
G
L
 
A
D
 
Q
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
V
H
 
G
A
 
Q
D
 
P
P
 
E
V
 
N
G
 
L
Q
 
H
I
 
P
V
 
L
Q
 
Q
K
 
K
A
 
A
W
 
W
L
 
V
D
 
L
T
 
H
A
 
G
V
 
G
A
 
A
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
S
G
 
P
G
 
G
Q
 
F
I
 
I
M
 
V
S
 
S
A
 
A
T
 
K
A
 
G
L
 
L
L
 
L
K
 
D
T
 
T
N
 
N
P
 
A
N
 
D
P
 
P
S
 
S
D
 
R
E
 
E
Q
 
D
I
 
V
E
 
R
E
 
D
A
 
W
M
 
F
V
 
Q
G
 
K
-
 
H
-
 
R
N
 
N
I
 
A
C
|
C
R
 
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
K
R
 
P
I
 
L
K
 
V
T
 
D
A
 
A
I
 
V
R
 
M
Q
 
D
A
 
A
S
 
A

Sites not aligning to the query:

3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
36% identity, 93% coverage: 4:148/156 of query aligns to 6:153/907 of 3fc4A

query
sites
3fc4A
L
 
I
K
 
T
L
 
V
N
 
N
G
 
G
K
 
I
D
 
E
H
 
Q
Q
 
N
L
 
L
D
 
F
V
 
V
T
 
D
E
 
A
D
 
E
M
 
A
P
 
L
L
 
L
L
 
S
W
 
D
A
 
V
I
 
L
R
 
R
D
 
Q
V
 
Q
A
 
L
G
 
G
Y
 
L
N
 
T
G
 
G
T
 
V
K
 
K
F
x
V
G
|
G
C
|
C
G
x
E
M
 
Q
G
|
G
L
x
Q
C
|
C
G
|
G
A
 
A
C
|
C
T
 
S
I
 
V
H
 
I
I
 
L
D
 
D
G
 
G
A
 
K
P
 
V
A
 
V
R
|
R
S
 
A
C
|
C
I
 
V
T
 
T
P
 
K
I
 
M
G
 
K
S
 
R
V
 
V
-
 
A
K
 
D
G
 
G
L
 
A
D
 
Q
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
V
H
 
G
A
 
Q
D
 
P
P
 
E
V
 
N
G
 
L
Q
 
H
I
 
P
V
 
L
Q
 
Q
K
 
K
A
 
A
W
 
W
L
 
V
D
 
L
T
 
H
A
 
G
V
 
G
A
 
A
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
S
G
 
P
G
 
G
Q
 
F
I
 
I
M
 
V
S
 
S
A
 
A
T
 
K
A
 
G
L
 
L
L
 
L
K
 
D
T
 
T
N
 
N
P
 
A
N
 
D
P
 
P
S
 
S
D
 
R
E
 
E
Q
 
D
I
 
V
E
 
R
E
 
D
A
 
W
M
 
F
V
 
Q
G
 
K
-
 
H
-
 
R
N
 
N
I
 
A
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
K
R
 
P
I
 
L
K
 
V
T
 
D
A
 
A
I
 
V
R
 
M
Q
 
D
A
 
A
S
 
A

Sites not aligning to the query:

3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
36% identity, 93% coverage: 4:148/156 of query aligns to 6:153/907 of 3fahA

query
sites
3fahA
L
 
I
K
 
T
L
 
V
N
 
N
G
 
G
K
 
I
D
 
E
H
 
Q
Q
 
N
L
 
L
D
 
F
V
 
V
T
 
D
E
 
A
D
 
E
M
 
A
P
 
L
L
 
L
L
 
S
W
 
D
A
 
V
I
 
L
R
 
R
D
 
Q
V
 
Q
A
 
L
G
 
G
Y
 
L
N
 
T
G
 
G
T
 
V
K
 
K
F
x
V
G
|
G
C
|
C
G
x
E
M
 
Q
G
|
G
L
x
Q
C
|
C
G
|
G
A
 
A
C
|
C
T
 
S
I
 
V
H
 
I
I
 
L
D
 
D
G
 
G
A
 
K
P
 
V
A
 
V
R
|
R
S
 
A
C
|
C
I
 
V
T
 
T
P
 
K
I
 
M
G
 
K
S
 
R
V
 
V
-
 
A
K
 
D
G
 
G
L
 
A
D
 
Q
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
V
H
 
G
A
 
Q
D
 
P
P
 
E
V
 
N
G
 
L
Q
 
H
I
 
P
V
 
L
Q
 
Q
K
 
K
A
 
A
W
 
W
L
 
V
D
 
L
T
 
H
A
 
G
V
 
G
A
 
A
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
S
G
 
P
G
 
G
Q
 
F
I
 
I
M
 
V
S
 
S
A
 
A
T
 
K
A
 
G
L
 
L
L
 
L
K
 
D
T
 
T
N
 
N
P
 
A
N
 
D
P
 
P
S
 
S
D
 
R
E
 
E
Q
 
D
I
 
V
E
 
R
E
 
D
A
 
W
M
 
F
V
 
Q
G
 
K
-
 
H
-
 
R
N
 
N
I
 
A
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
K
R
 
P
I
 
L
K
 
V
T
 
D
A
 
A
I
 
V
R
 
M
Q
 
D
A
 
A
S
 
A

Sites not aligning to the query:

1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
36% identity, 93% coverage: 4:148/156 of query aligns to 6:153/907 of 1sijA

query
sites
1sijA
L
 
I
K
 
T
L
 
V
N
 
N
G
 
G
K
 
I
D
 
E
H
 
Q
Q
 
N
L
 
L
D
 
F
V
 
V
T
 
D
E
 
A
D
 
E
M
 
A
P
 
L
L
 
L
L
 
S
W
 
D
A
 
V
I
 
L
R
 
R
D
 
Q
V
 
Q
A
 
L
G
 
G
Y
 
L
N
 
T
G
 
G
T
 
V
K
 
K
F
x
V
G
|
G
C
|
C
G
x
E
M
 
Q
G
|
G
L
x
Q
C
|
C
G
|
G
A
 
A
C
|
C
T
 
S
I
 
V
H
 
I
I
 
L
D
 
D
G
 
G
A
 
K
P
 
V
A
 
V
R
|
R
S
 
A
C
|
C
I
 
V
T
 
T
P
 
K
I
 
M
G
 
K
S
 
R
V
 
V
-
 
A
K
 
D
G
 
G
L
 
A
D
 
Q
I
 
I
S
 
T
T
 
T
I
 
I
D
 
E
G
 
G
L
 
V
H
 
G
A
 
Q
D
 
P
P
 
E
V
 
N
G
 
L
Q
 
H
I
 
P
V
 
L
Q
 
Q
K
 
K
A
 
A
W
 
W
L
 
V
D
 
L
T
 
H
A
 
G
V
 
G
A
 
A
Q
|
Q
C
|
C
G
|
G
Y
 
F
C
|
C
Q
 
S
G
 
P
G
 
G
Q
 
F
I
 
I
M
 
V
S
 
S
A
 
A
T
 
K
A
 
G
L
 
L
L
 
L
K
 
D
T
 
T
N
 
N
P
 
A
N
 
D
P
 
P
S
 
S
D
 
R
E
 
E
Q
 
D
I
 
V
E
 
R
E
 
D
A
 
W
M
 
F
V
 
Q
G
 
K
-
 
H
-
 
R
N
 
N
I
 
A
C
|
C
R
|
R
C
|
C
G
 
T
T
 
G
Y
 
Y
N
 
K
R
 
P
I
 
L
K
 
V
T
 
D
A
 
A
I
 
V
R
 
M
Q
 
D
A
 
A
S
 
A

Sites not aligning to the query:

Query Sequence

>Pf6N2E2_5938 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)
MITLKLNGKDHQLDVTEDMPLLWAIRDVAGYNGTKFGCGMGLCGACTIHIDGAPARSCIT
PIGSVKGLDISTIDGLHADPVGQIVQKAWLDTAVAQCGYCQGGQIMSATALLKTNPNPSD
EQIEEAMVGNICRCGTYNRIKTAIRQASTHLKEAKA

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory